KEGG   Saccharomonospora sp. 31sw: EYD13_15745Help
Entry
EYD13_15745       CDS       T05928                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sacc  Saccharomonospora sp. 31sw
Pathway
sacc00071  Fatty acid degradation
sacc00072  Synthesis and degradation of ketone bodies
sacc00280  Valine, leucine and isoleucine degradation
sacc00310  Lysine degradation
sacc00362  Benzoate degradation
sacc00380  Tryptophan metabolism
sacc00620  Pyruvate metabolism
sacc00630  Glyoxylate and dicarboxylate metabolism
sacc00640  Propanoate metabolism
sacc00650  Butanoate metabolism
sacc00900  Terpenoid backbone biosynthesis
sacc01100  Metabolic pathways
sacc01110  Biosynthesis of secondary metabolites
sacc01120  Microbial metabolism in diverse environments
sacc01130  Biosynthesis of antibiotics
sacc01200  Carbon metabolism
sacc01212  Fatty acid metabolism
sacc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EYD13_15745
   00630 Glyoxylate and dicarboxylate metabolism
    EYD13_15745
   00640 Propanoate metabolism
    EYD13_15745
   00650 Butanoate metabolism
    EYD13_15745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EYD13_15745
   00072 Synthesis and degradation of ketone bodies
    EYD13_15745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EYD13_15745
   00310 Lysine degradation
    EYD13_15745
   00380 Tryptophan metabolism
    EYD13_15745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EYD13_15745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EYD13_15745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EYD13_15745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sacc04147]
    EYD13_15745
Enzymes [BR:sacc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EYD13_15745
Exosome [BR:sacc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EYD13_15745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: QBQ61497
UniProt: A0A4P7CEE2
Position
complement(3421147..3422325)
Genome map
AA seq 392 aa AA seqDB search
MSGSVILGAARTPVGKLLGSLKDFSGAQLGGIAIKAALERAGVPADAVQYTIMGQVLTAG
AGQIPARQAAVAAGIPMDVPALTINKVCLSGLDAIALADQLIRAGEFDLVVAGGQESMSQ
APHLLPKSRTGVKYGNATLLDHMAHDGLFCAFDQVAMGESTERHNSRYGLTREEQDAFSA
RSHQRAAKAAANGVFDDEIVPVEIPQRKGDPVLFSSDEGVRADTTAEGLARLRPAFAADG
TITAGSASQISDGAAAVVVASRAKAEELGITPLAEIGAHGVVAGPDASLHEQPSNAIKAA
LAKAKLDADALDLVEINEAFAAVGLVSARKLGLDEEKVNVNGGAIAIGHPIGASGARLVV
HLVHELRRRGGGLGAAALCGGGGQGDALLLKV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggttccgtgatcctgggcgccgcccgcaccccggtcggaaagcttctcggctcg
ttgaaggatttctccggcgcgcagctgggtggaatcgccatcaaggcggcgttggagcga
gccggcgttccggctgatgccgttcagtacacgatcatggggcaggtgctcaccgcgggc
gcgggacagatcccggcgcgccaggccgccgtcgccgcgggcattcccatggacgtcccc
gcgctgaccatcaacaaggtgtgtctgtcgggtctcgacgccatcgcgctcgccgaccag
ctgattcgtgccggcgagttcgacctcgtcgtcgcgggcggccaggagtccatgtcgcag
gcgccgcacctgctgccgaagtcgcgcaccggtgtcaagtacggcaatgccaccctcctg
gaccacatggctcacgatggtctgttctgcgcgttcgaccaggtggcgatgggcgagtcc
accgagcgccacaactcccgttacggcctgacccgtgaggagcaggacgccttctcggcc
cgatcgcaccagcgcgctgccaaggccgctgccaacggtgtgttcgacgacgagatcgtt
cccgtcgagatcccgcagcgcaagggtgaccccgtgctgttctcctcggacgagggtgtg
cgggccgacaccaccgccgagggactggcgaggctgcggcctgcgttcgcagccgatggc
acgatcacggcggggtcggcgtcccagatctccgacggtgcggccgctgtcgtcgtggcg
agcagggcgaaggcggaggaactcggcatcaccccgcttgccgagatcggcgcacatggc
gtggtggcaggtcccgacgccagcctccacgagcagccgtccaacgcgatcaaggctgct
ctcgccaaggcgaagctggacgcggacgccctcgacctcgtggagatcaacgaggcgttc
gccgccgtgggcctggtgtccgcgcgcaagctcggcctcgacgaggagaaggtcaacgtc
aacggcggtgccatcgcgatcggccaccccatcggcgcctccggcgcgcgtctcgtcgtg
cacctggtgcacgagctgaggcgcaggggcggcggtctcggcgcggccgcgctgtgtggc
ggtggcggccagggcgacgcgctgctgctcaaggtctga

DBGET integrated database retrieval system