KEGG   Sulfodiicoccus acidiphilus: HS1genome_1066Help
Entry
HS1genome_1066    CDS       T05813                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sacd  Sulfodiicoccus acidiphilus
Pathway
sacd00220  Arginine biosynthesis
sacd01100  Metabolic pathways
sacd01110  Biosynthesis of secondary metabolites
sacd01130  Biosynthesis of antibiotics
sacd01230  Biosynthesis of amino acids
Module
sacd_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sacd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    HS1genome_1066
Enzymes [BR:sacd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     HS1genome_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BBD72677
UniProt: A0A348B3C5
Position
complement(1012690..1013475)
Genome map
AA seq 261 aa AA seqDB search
MAILLEKPSTRTRVSFESAVAALGGHPIVFTGMDLQLSRGEPVEDTGRVLGKYVHGIGAR
VLRHETLIKLSRSSGVPVLNLLSDAEHPLQALSDLFTMKEHFGRIPKIAFVGDGGDNVLA
SLMGAVAKLGLELNVASPKELKPSEDVLRKVEEESELTDATVEFFEDPYQAVRGVKVVYT
DVWVSMGKESEADRRRSILRPYAVTNDLMSYASSDAVFMHCLPAVRGEEVESSVIDGPRS
LVWTQAENKFFGAMAALVFTL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatactgttggagaagcccagcactcgaacgagagtgagcttcgagtcggccgta
gcggcgttagggggtcatccgatcgttttcaccgggatggatcttcaactgagcaggggt
gagccagttgaagacacggggagagtccttgggaagtatgtgcacggcataggagctagg
gttttacgccacgaaaccctgatcaagttgagtaggagctccggagtcccagtcctcaac
ttactcagtgacgcggaacatccactccaagccctctcggatctattcacgatgaaggaa
cacttcggccgtattccgaaaattgccttcgtgggtgatggtggcgataatgtgctggct
agcctcatgggtgcagtagccaagctgggattagaacttaacgtcgcttcacctaaggaa
ctcaagccctcggaggacgtgttaaggaaggtggaggaggagtccgaactgactgatgcg
actgtcgagttcttcgaggatccctatcaagccgtgaggggagtgaaggtcgtgtacact
gacgtctgggtgagcatgggcaaggagtcggaggcggataggcgcaggtccattctcagg
ccctacgctgtgacgaacgaccttatgtcgtacgcgtcatctgacgcggtctttatgcat
tgtctgccggcggtgagaggtgaggaggtggagagctctgtgatagatggtccgaggagc
ctagtctggacccaagccgagaacaagttctttggggctatggccgccctagtcttcaca
ttgtga

DBGET integrated database retrieval system