KEGG   Saccharopolyspora sp. ASAGF58: FDZ84_29705
Entry
FDZ84_29705       CDS       T06538                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
sacg  Saccharopolyspora sp. ASAGF58
Pathway
sacg00903  Limonene and pinene degradation
sacg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sacg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FDZ84_29705
Enzymes [BR:sacg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     FDZ84_29705
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: QIZ37981
UniProt: A0A6H1RC28
Position
6334081..6334914
AA seq 277 aa
MTGRVQDRIAFITGAGRGQGRSHAIRLAEEGADIIAVDLCKPVEGVPYEMSDSADLEETA
RAVEALGRRVVTAEVDVRDLTTLQTVLDDAVAQLGGLDIVSANAGIAGPFAPADELDPVG
WQTTVDINLTGVYNAARASIGHLKARGGGSMVLTSSMAGLKAYLNAANYVSAKHGVLGLM
KALALELAPFSIRVNSLHPTQVDTPMIQNPAMYRLFCPDKESPTEADFKVASGASNALPV
PWVEAVDVSNALLFLASDEGRYITGAALPVDAGCNLL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaccggacgggtgcaggatcggatcgcattcatcaccggagcggggcgcggtcagggc
cgcagccacgcgatccggctggcggaggagggcgccgacatcatcgccgtcgacctctgc
aagccggtcgagggtgttccctacgagatgtcggattccgcggacctggaggagaccgcc
cgggccgtcgaggccctcggtcgccgcgtcgtaaccgccgaggtcgacgtccgcgacctg
acgacgctgcagacggtgctcgatgacgcggtcgcccagctcggcgggctcgacatcgtg
tcggcgaatgcgggtatcgctgggcctttcgctcccgccgacgagctcgatccggtgggg
tggcagaccaccgtcgacatcaacctgaccggcgtctacaacgccgcgcgggcgtcgatc
ggccacctgaaggctcgcggtggcggctcgatggtgctcaccagctcgatggcggggctc
aaggcctatctgaacgcggcgaactacgtgtcggccaagcacggtgtgctggggctgatg
aaggcgctcgccctcgagctcgctccgttcagcatccgggtgaacagcctccaccccacc
caggtggacacccccatgatccagaaccccgcgatgtacaggctgttctgcccggataag
gaatcgccgaccgaggccgacttcaaggtcgcctccggtgcgagcaacgccctgccggtg
ccgtgggtggaggcggtggacgtctcgaacgccctgctcttcctggcgtcggacgagggg
cgctacatcacgggtgccgcgctgccggtcgacgcggggtgcaacctgctatga

DBGET integrated database retrieval system