KEGG   Singulisphaera acidiphila: Sinac_1600Help
Entry
Sinac_1600        CDS       T02393                                 

Definition
(GenBank) phospholipid N-methyltransferase
  KO
K22309  ornithine lipid N-methyltransferase [EC:2.1.1.344]
Organism
saci  Singulisphaera acidiphila
Brite
KEGG Orthology (KO) [BR:saci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sinac_1600
Enzymes [BR:saci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.344  ornithine lipid N-methyltransferase
     Sinac_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_12 TrkA_N Methyltransf_31 MTS PRMT5 Methyltransf_19 FtsJ Methyltransf_5 PCMT Met_10 Methyltransf_2 Methyltransf_16 GCD14 Ubie_methyltran Methyltransf_23 Methyltransf_3 TRM13
Motif
Other DBs
NCBI-ProteinID: AGA25979
UniProt: L0D9B6
Position
complement(2014369..2014947)
Genome map
AA seq 192 aa AA seqDB search
MKDFFLFLGKFFKHGTAIASLAPSSPWLSRTTVRNIPWENARVVVELGAGTGPITKVIAD
RVHPDCRVIVLERDPDFARLLRERFANRANFDVVEGDVRDLTQILQQRGIEQADFVVSGL
PVPSFPKELQRDLFRVVKQVLAPSGTFNQITEMPWVYQRFYRRFFDEVTFVFEPRNLPPA
GAYFCRGVKESF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttctttctgttcctcggcaagttcttcaagcacggaacggcgatcgccagc
ctggcgccaagcagcccctggctctcgcgaacgaccgtccgcaacatcccttgggaaaat
gcccgggtcgtcgttgagctgggggccggtacaggtcccatcaccaaggtgatcgccgac
cgggtccatcccgattgccgggtcatcgtcctcgagcgagatcccgacttcgcccggctc
ctccgcgaacggttcgcgaaccgcgccaacttcgacgtggtcgaaggggacgtgcgcgat
ctcacccagattctccaacagcgcgggatcgagcaggctgacttcgtagtctccggcctc
cccgttccatcgttcccgaaagagctgcaacgcgacctctttcgagtcgtcaagcaggtg
ctcgccccgtcgggaacgttcaaccagatcaccgagatgccgtgggtctatcagcggttc
tatcgccggttcttcgacgaggtcacgttcgtcttcgaaccccgcaaccttcccccggcc
ggtgcctatttctgccggggcgtgaaggaaagtttctga

DBGET integrated database retrieval system