KEGG   Singulisphaera acidiphila: Sinac_2414
Entry
Sinac_2414        CDS       T02393                                 

Definition
(GenBank) FHA domain-containing protein
Organism
saci  Singulisphaera acidiphila
SSDB
Motif
Pfam: FHA Yop-YscD_cpl zf-ribbon_3 zinc_ribbon_2 UPF0547 DUF2012 DZR zinc_ribbon_15
Other DBs
NCBI-ProteinID: AGA26725
UniProt: L0DCX9
Position
2976415..2977911
AA seq 498 aa
MAQICPRCDATVGDDLTRCPSCGADLDPCRTIPPARPRQITPAKAPVSARKASPVERPDY
SDERETATPPPPPRPIKKIKPRPVAPQPTAQAPSAAPPAPQPAQPGPKLAYTPSSTTGEM
AAYAPPAYPTPAPAPAESRGGIRGWMIKMLGGAPAAPPQPQPHPAPAPVPPNYGYVPPGG
APPQPGAHPGYPPGVAPQAPAALHQAPPQGHFQAPPPGWPDQPPVPGFGLQHPGPQGAGA
PPHLDAPPSLLDPFGGGSDEYAKTQFLGGVDLDKLKIPKYTFTLQILDNQGQWRDWGPIH
ANGLNVGRAKTSAEFPGLSSMAVRHMKLRYERTTLVVEDLGSINGVYLRVIQPTELSDGM
RFRVGNQTIEFHEPAAFEPVAPLVGEDGEEYCSRDLEPLAYLDLIRPNGQPGLRFPLTKP
DATIIGREGPNTHIALTSDNSVSGMHARVYRKDGKFILEDLKSRNGTFVHVLGSAKVTSG
DVLLAGLVLFRVVDHGNG
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcgcaaatctgtccccgatgtgatgcgactgtcggcgacgatcttacgcgctgtccc
agttgcggagccgatctcgacccctgtcgaacgatcccaccggcacgcccgagacagatc
acgccggcgaaagctccggtctcggctcgaaaagcaagtccggtggaacgaccggactat
tccgacgagcgggagacggccaccccgcctccaccgcccaggccgatcaagaaaatcaaa
ccacggcccgttgcgccacagccgacggcccaggccccaagcgccgcacctccggctccg
caacctgcgcaaccgggccctaagctcgcttacacaccgtcgtcgaccaccggcgagatg
gcggcctatgctcctccggcctatccgaccccggctcccgcgccggcagaaagtcgaggc
ggcattcgtggctggatgatcaagatgctcggcggagcaccggccgctccgccacagcct
cagccccatcccgcaccagcgccggttcccccgaattacggctatgtgcctcccggtgga
gccccgccgcagcccggggcacatccagggtatccgccaggtgtggctcctcaggccccc
gcagccctgcaccaggccccaccgcaaggccattttcaagccccccctcccggatggccc
gatcagccacctgttcctggatttgggttgcagcatcccggcccacaaggggctggagca
ccccctcatctcgacgcccctccctccttgctcgacccctttggaggggggtcggacgag
tatgccaagacccagttcttggggggagtcgacctcgataagctgaagatccccaagtac
accttcacgctccagatccttgataatcaaggacaatggcgtgattggggcccgatccat
gccaacggcctgaatgtcggtcgtgccaagacgagcgccgagtttcccgggctcagcagt
atggccgtacggcacatgaagctacgttatgagcgcacaacgctggtcgtcgaggatctc
ggatcaatcaacggcgtttacctgcgcgtgattcagccgaccgaactgagcgacggaatg
cgtttccgagttggcaaccagacgatcgagtttcacgaaccggccgctttcgagccggtg
gctccgttggtcggagaagacggcgaagaatactgtagtcgggatctcgaaccgttggcc
tatctcgatctcatccgccccaacggtcagccgggccttcgcttcccgctcaccaagccg
gatgcgacgatcatcggccgcgagggaccgaacacgcacatcgccttgaccagcgacaat
tccgtgagcggcatgcacgcgcgggtctatcgcaaggacggcaagtttatcctcgaagat
ctgaagagccgcaacggcacgttcgtccatgtgctgggctcggccaaggtcacttcaggc
gacgtgctcttggccggcctcgtcttgttccgagtcgtcgatcatggcaacggctga

DBGET integrated database retrieval system