KEGG   Singulisphaera acidiphila: Sinac_2514Help
Entry
Sinac_2514        CDS       T02393                                 

Definition
(GenBank) hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00010  Glycolysis / Gluconeogenesis
saci00030  Pentose phosphate pathway
saci00051  Fructose and mannose metabolism
saci00680  Methane metabolism
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01120  Microbial metabolism in diverse environments
saci01130  Biosynthesis of antibiotics
saci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinac_2514
   00030 Pentose phosphate pathway
    Sinac_2514
   00051 Fructose and mannose metabolism
    Sinac_2514
  09102 Energy metabolism
   00680 Methane metabolism
    Sinac_2514
Enzymes [BR:saci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Sinac_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AGA26821
UniProt: L0DDT1
Position
3119579..3121570
Genome map
AA seq 663 aa AA seqDB search
MDPQALNDNDVSGQGIRDDDLITLRALSGRFPDIDSATAEIARLAAVLTLPKGTVHVISD
VHGEDKKLRHVINNASGTLRPLVQGLFAGRMTPEEFREFLTLIFYPAEVVERLQHTLLDL
ESLRSYCTRTLRYEFELVRVLAARYSLKRAMHVFPPEYRELMAEMLHQPTTERDEAFAQA
IVDALLSRGRALHLIHLTARLVRNLAISELIIGGDCWDRGPRGDRVVDYLRQQPNVSFIW
GNHDVAWLGASFGHEALICHVLRLSLRYRRLGQLDEGYSIPLTPLEHLARTVYADDPAAG
FMPKLSGMRPDLLVARMQKAAAVMQFKLEGQVIARNPEWEMEHRRLLHHIDLAEKTIEVD
GVRYPLSDAYLPTLDPAAPYELSEDEQLCIDRLRRSFVASQKLGEHMLYLVSHGAMYLVR
DGCLIFHGCAPVDRAGEFLTMNIEGVPLAGRALFDAIGKAILRAAGHRARKDLDLLWYLW
GGERSPLFGKDRITTLERDFIADKATHHETMNPYFELIHEPWFCDRILREFNVDPKDALI
VNGHVPVRIEKGENPIKRSGKAITIDGAFSEAYGDHGYTLVLEANRILLAEHSHFESVEA
AIRDGVDIIPKVSVVRTWDRPHRIADTERGDQIRGEVRMLERLIAAYRNNELRQSGQRPW
APR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcaggccctcaacgacaatgacgtcagtggtcagggcatccgcgacgatgat
ctgatcacgctccgcgccctctccggccggttcccggacatcgactcggccacggcggag
atcgcccgcctggccgcggtactgacgctgcccaaggggaccgtccacgtcatcagcgac
gtccacggcgaggacaagaagctccggcacgtcatcaacaacgcctccggcaccttgcgc
ccgctcgttcaggggctgttcgccgggaggatgacccccgaggagtttcgggagttcctg
acgctcattttctacccggccgaggtggtcgaacgactccaacacaccttgctcgacctc
gagtctctgcgttcgtactgcacccggaccttacggtacgagttcgagttggtccgggtc
ctcgcagcgcgttacagcctgaaacgggccatgcatgtcttcccgcctgaataccgcgaa
ctcatggcggagatgcttcaccagccaacgaccgagcgagacgaggcattcgcccaagcg
atcgtcgacgcactcctgagccgaggccgagcgctccacctgatccacctcacggcaaga
ctcgtccggaacctggcaatctccgagttgatcatcggcggcgactgctgggaccggggg
ccgaggggcgaccgcgtggtcgactacctgcgccagcagccgaatgtctcgttcatctgg
ggcaatcacgacgtcgcctggctgggggcaagcttcgggcacgaggccctgatctgtcac
gtgctccggctatcattgcggtatcggcgactgggccagctcgacgaaggatacagcatc
cccctcaccccactggagcacctggccaggacagtctatgccgacgacccggcggccgga
ttcatgcccaagttgagcggcatgcgaccggacttgctcgtcgcccggatgcagaaggcg
gccgccgtgatgcagttcaagctcgaagggcaggtgatcgcccgcaaccctgagtgggag
atggaacaccgccgcctgctccatcacatcgacctcgccgaaaagaccatcgaggttgac
ggcgtccgctatcccctaagcgacgcgtacctgccgaccttggatccggccgccccctac
gagctttccgaggacgagcaactctgtatcgaccgcctgcgccgctcgttcgtggccagc
cagaagctcggcgagcacatgctctacctcgtgagccacggggcgatgtacctcgttcgt
gacggttgcttgatcttccatggatgcgcaccggtcgaccgggccggcgagttcctcacg
atgaatatcgagggagtaccattggccgggcgcgcactcttcgacgcgattggcaaggcc
atcctccgagcggccggtcatcgggcccggaaagacctggatctgctctggtatctctgg
ggaggggaacgctcccccttgttcggtaaagaccggatcacgaccttggagcgcgacttc
atcgcggacaaggccacacaccatgagaccatgaatccctatttcgagctgattcacgag
ccctggttctgcgaccggatcctccgcgagttcaacgtcgatcccaaggacgccctgatc
gtcaacggccacgtcccagtgcgaatcgagaaaggggagaacccaatcaagcgcagtggc
aaggcgatcacgatcgacggtgccttctccgaggcgtacggcgaccacggctacactctg
gtgctagaagccaaccgaatcttgctggccgagcactcgcacttcgagtcggtggaggcc
gcaatccgtgacggcgtggacatcatccccaaagtctcggtcgtccggacctgggaccgg
ccccaccgcatcgccgacaccgagcgcggcgaccagatccgtggcgaggtcaggatgctc
gagcggctgatcgcagcttaccgcaacaatgaactgcggcagagcggccagcggccttgg
gccccccgataa

DBGET integrated database retrieval system