KEGG   Singulisphaera acidiphila: Sinac_2860Help
Entry
Sinac_2860        CDS       T02393                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00040  Pentose and glucuronate interconversions
saci00052  Galactose metabolism
saci00500  Starch and sucrose metabolism
saci00520  Amino sugar and nucleotide sugar metabolism
saci01100  Metabolic pathways
saci01130  Biosynthesis of antibiotics
Module
saci_M00362  Nucleotide sugar biosynthesis, prokaryotes
saci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sinac_2860
   00052 Galactose metabolism
    Sinac_2860
   00500 Starch and sucrose metabolism
    Sinac_2860
   00520 Amino sugar and nucleotide sugar metabolism
    Sinac_2860
Enzymes [BR:saci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sinac_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGA27152
UniProt: L0DD28
Position
complement(3591875..3592846)
Genome map
AA seq 323 aa AA seqDB search
MQITKAVITAAGRGARQYPASDTVQKAMLPLVDRDGLTKPILQIIAEEAIESGIEEICIV
SAPGDESVYRSHFRNYAQNLRSSFRGFEWAEEQARRLDDLEHRLRFAVQPEPQGYGHAVW
CAREFVAGAPFLLLLGDHLYISSETRRCARQLIDLVADEGCSVSGVQATREHLIHQYGTL
TGKRRHDLPTVYAIDEIIEKPNPTLAELKLQVPGLRAGHYLCFFGIHVLTPAVFDLLDHL
VRTDAREQGQIQLTTALNELARREKYLALETRGSRYNLGVKFGFVEAQIALALAGADRER
MLAGLLESIVRIEQNHGASDLAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcaccaaggcggtcatcacggcggccggccggggagcccggcagtatccggcc
tccgacacagtgcaaaaagcgatgctgccgctggtcgatcgtgacggtctgaccaagccg
attctccagatcatcgccgaagaggcgatcgagagtggaatcgaggagatctgcatcgtc
agcgctccgggcgacgagtcggtctaccggagccatttccgaaattacgcacagaacctg
cggtcgtcgttccgtggtttcgagtgggccgaggaacaagcccgccggctcgacgacctg
gagcaccggcttcggtttgccgttcagcccgagcctcagggatacggccacgcggtctgg
tgcgcccgcgagttcgtcgccggcgctccctttctcttgctcctgggtgaccacctctat
atctcgagtgagacgaggcgctgcgcccgccagttgatcgacctggtcgcggacgagggg
tgttccgtctctggggtgcaggcgactcgcgaacacctgatccaccagtacggcacgctc
accgggaagcggcggcacgacctgccgaccgtctacgcgatcgatgagatcatcgagaag
ccgaacccgacgctggccgagttgaagcttcaagtgcccggcctccgcgcggggcactac
ctctgtttctttggaatccacgtgttgacgccggcggtcttcgacctgctcgatcatctc
gtcaggaccgatgcgcgggagcaagggcagattcaattgaccacggccctgaacgaactc
gcgcgtcgggagaaatacctggcgctcgagacgcgggggtcgcgatacaaccttggggtg
aagttcgggttcgtcgaagcgcagattgccctggcgcttgcgggcgcggaccgagagcgg
atgcttgccggtctgctcgagtcgatcgtgcggatcgaacagaaccatggggcttcggac
ctggcgctttga

DBGET integrated database retrieval system