KEGG   Singulisphaera acidiphila: Sinac_4927Help
Entry
Sinac_4927        CDS       T02393                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00540  Lipopolysaccharide biosynthesis
saci01100  Metabolic pathways
Module
saci_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:saci00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Sinac_4927
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:saci01005]
    Sinac_4927
Enzymes [BR:saci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Sinac_4927
Lipopolysaccharide biosynthesis proteins [BR:saci01005]
 Unusual sugar
  Sinac_4927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 adh_short Ldh_1_N 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AGA29083
UniProt: L0DJS1
Position
6142867..6143847
Genome map
AA seq 326 aa AA seqDB search
MIVVTGAAGFIGSNLAHRLAALGHHLWLVDHPFSAVKTANWVGLSRFCFTTEEIFLQALR
SRDLPIEAVFHLGACSRTTETDWGYLLRNNVEFSQMLWTWCSEAGKPFYYASSAATYGDG
SNGFDDRLPPSELRPLNLYGKSKNTFDLWVWRWVAEGLPTPPGWAGLKFFNVYGPREDHK
GSMASVVWQTCRQILATGEMHLFKSNDPRYPDGGQRRDFVFVEDCIDHLLWLWENPGVCG
LFNSGTGVARTFEDLARAVFGALGREPRIGYIDMPAELCKQYQNFTRADMTKLQAAGFSR
PATTLEAGVASAITITTSVDPTENPK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtcacgggggccgccgggtttatcggctcgaaccttgcccaccgcctggcc
gcgttggggcatcacctctggctcgtcgatcacccgttctcggcagtgaagacggcgaac
tgggtcgggctgagccgattctgtttcacgaccgaagagatcttcctccaggctttgcga
tcccgcgacctcccgatcgaggcggtctttcatctgggggcgtgtagccgcacgaccgag
acggactggggctacctgctgcggaacaacgtcgagttctcgcagatgctctggacgtgg
tgttccgaggcagggaagccgttctactacgcctccagcgccgcgacctacggagacggg
tcgaacggcttcgacgaccgccttccaccctcggaacttcggccgctgaacctctatggg
aagagcaagaacacgttcgacctctgggtctggagatgggtcgccgaggggttgccaacc
ccgccaggctgggctgggttgaagttcttcaacgtctacggcccgagagaagaccacaag
ggatcaatggcgagtgtcgtctggcagacctgtcgccagatcctggcgaccggggagatg
cacctcttcaaatccaacgatccgaggtaccccgacggtggccagcggcgcgatttcgtg
ttcgtggaggactgcatcgatcacctgctctggctttgggagaacccgggtgtttgtggt
ctcttcaacagcgggaccggagttgcccgaacctttgaggatctggctcgggccgtcttt
ggcgccttgggccgtgagcctcggatcggctacatcgacatgcccgctgaactttgcaag
cagtatcagaatttcactcgagccgacatgacgaagcttcaggccgcagggttttcccgg
ccggcgacgactctggaagccggcgtcgcaagcgcgattacgatcacaacctcagtagac
ccgacggagaatccgaaatga

DBGET integrated database retrieval system