KEGG   Singulisphaera acidiphila: Sinac_6548Help
Entry
Sinac_6548        CDS       T02393                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00010  Glycolysis / Gluconeogenesis
saci00020  Citrate cycle (TCA cycle)
saci00620  Pyruvate metabolism
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01120  Microbial metabolism in diverse environments
saci01130  Biosynthesis of antibiotics
saci01200  Carbon metabolism
Module
saci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinac_6548
   00020 Citrate cycle (TCA cycle)
    Sinac_6548
   00620 Pyruvate metabolism
    Sinac_6548
Enzymes [BR:saci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sinac_6548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Methyltransf_18 RnfC_N DUF2118
Motif
Other DBs
NCBI-ProteinID: AGA30623
UniProt: L0DP43
Position
complement(8236201..8237496)
Genome map
AA seq 431 aa AA seqDB search
MPIEVTMPKLSPTMESGVLSQWLVKVGDQVKEGDLLADIETDKATMPMKAFDDGVVAHLD
YAVGDEIQLGDRVLVLARKGEDAKQVAAGLSSKKAAGASKPKSAANGSDQPEAQHGAGSN
GQDAHEAAEVVAVAAQGGASQGGRIKSSPLARKIAAASQVDLGSVPGSGPGGRVIRDDVE
LFLKTRGSAAAPAARPAAPTRTLAAERIPHTRMRKTIAQRMVEAKKVAPEIHVTVDIRAD
ALVAVREQLNKQLAPEKIKLSLGDFVTKGVALALRRHPGVNASYEPDAIVRHGEVNVGIA
VALDGGLIVPVLRNADTLGLREVRLGSDALVQAARSNKLSPEQMSGGTFTISNLGMYGVR
QFDAILNLPEVAILAVGAAEKRPVVQGDSLVVGTVMTVTLTADHRAVDGALAAEFLRTLK
GFLEEPASMLL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatcgaagtgacgatgcccaagctcagccccaccatggagagcggggtcctcagc
cagtggctggtcaaggtcggcgaccaggtcaaagaaggtgatcttctggccgacatcgag
accgacaaggcgaccatgccgatgaaggcgttcgacgacggtgtcgtcgcacacctcgac
tacgccgtcggcgatgagatccagcttggcgatcgcgtcctggtcctcgcccgcaaggga
gaagacgcgaagcaggtcgcggcggggctgagcagcaagaaggcggcaggcgcgtccaag
cccaagtccgcagccaacggctcggatcagcccgaggcgcagcatggcgcagggagcaat
ggccaggacgctcacgaagcggccgaggtcgtggctgtggcggctcaagggggcgcaagc
cagggcggccggatcaagtcgagcccgctggcgcggaagatcgcggcggcctcgcaggtc
gacctcgggagcgttcccgggagcggaccgggcggccgtgtgatccgagatgacgtcgag
ctcttcctcaagacgcgtggctccgccgctgcacccgcggcgcggcctgccgcaccgacc
cgaaccctggccgccgagcggatcccgcacacgaggatgcgcaagacgatcgcccagcgg
atggttgaggccaagaaggtcgctcccgaaattcacgtgaccgtggatatccgggccgac
gccctcgtggctgtccgtgagcaactgaacaagcagctcgctcccgagaagatcaagctc
tccctgggcgacttcgtcaccaagggggttgcccttgccctccgccgccatcctggcgtc
aacgcctcgtacgagcccgatgcaatcgtccggcatggcgaggtcaacgtcgggattgcg
gtggcgctggatgggggcctgatcgtccctgttcttcgcaatgccgacacgctcggcctt
cgcgaagtccggctcggcagcgacgccctggtgcaggctgctcggagcaacaagctttca
cccgagcagatgagcggcgggacgttcacgatcagcaaccttgggatgtacggcgtccgc
cagttcgacgccattttgaacctccccgaagttgcgattctcgccgttggggccgctgag
aagaggcccgttgttcaaggggattcgctggtcgtgggcacggtgatgaccgtgaccctc
accgccgaccaccgcgctgtcgatggtgccctggccgccgaatttctccggactctgaag
ggtttcctcgaagaaccagcgtcgatgctcctttaa

DBGET integrated database retrieval system