KEGG   Sulfolobus acidocaldarius N8: SacN8_06945Help
Entry
SacN8_06945       CDS       T02452                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
sacn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sacn01100  Metabolic pathways
sacn01110  Biosynthesis of secondary metabolites
sacn01130  Biosynthesis of antibiotics
sacn01230  Biosynthesis of amino acids
Module
sacn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SacN8_06945 (trpC)
Enzymes [BR:sacn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SacN8_06945 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AGE71353
UniProt: M1I5H7
Position
1218619..1219365
Genome map
AA seq 248 aa AA seqDB search
MPRFLNGWLTDVVQASLSRPKIEKVRDRPIFSLKKSIISAKNSGLNPIIAEYKRRSPSGI
NVDINIIEYVKFMENNGATGISVLTEEKFFNGSYNDLELVAKNVKLPILMKDFVVSEKQI
DSAYNIGADVILLIAKILTERELVSLYKYAKSYGLEAIVEISDEEDLDVALRGNYDFIGV
NARNLESLEVSLDRTKKLLQMIPKDRLKIAESGISTRQDIEELRASGADAFLIGTSLLKD
QNKIKELI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccgagatttctaaatggttggttaactgatgttgtacaagcctccctctcccgacct
aaaatagaaaaggtaagagatagacctatcttctccttaaaaaaaagtataatttctgct
aagaattcaggattaaatcctataatagcagaatataaaagaaggtctccctctgggata
aatgtagatattaacattatagaatatgtaaaatttatggagaataatggtgcgacagga
ataagtgttttaacagaagaaaagttctttaacggtagttataatgacctggaactagtt
gcaaagaatgtaaaattacccatactaatgaaagattttgtagttagtgaaaaacaaata
gattctgcatacaatataggagcagatgttatattattaatagcaaaaatattgacggag
agagagctggtcagtttatacaagtatgctaaatcttacggactagaggcaatagtagaa
atatcagatgaggaggacttagatgtagctttaagaggtaattatgatttcataggggta
aatgctagaaatcttgagtcactagaggtaagtttagatagaactaaaaaattacttcaa
atgatacctaaggataggttgaaaatagctgaaagtggtattagtactagacaagacatt
gaggaactcagagcttccggtgcagacgctttcctcataggtacatccttattaaaggat
cagaataaaataaaggagttgatttaa

DBGET integrated database retrieval system