KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_08465Help
Entry
SacRon12I_08465   CDS       T02453                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K15038  succinyl-CoA reductase [EC:1.2.1.76]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Pathway
sacr00720  Carbon fixation pathways in prokaryotes
sacr01100  Metabolic pathways
sacr01120  Microbial metabolism in diverse environments
sacr01200  Carbon metabolism
Module
sacr_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sacr00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SacRon12I_08465
Enzymes [BR:sacr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     SacRon12I_08465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LPD23
Motif
Other DBs
NCBI-ProteinID: AGE73924
UniProt: M1J3A1
Position
complement(1496803..1498209)
Genome map
AA seq 468 aa AA seqDB search
MSETIEVVSPSNLKVIGKVKRMSRDDVRAQIEEADKGFEDISSLPLYKRTAILKRASDII
EREKERLARLLALEAGKPIKDARVEVTRASRLFRQAGEEAVFVLEGKNYRVDGYEYPPGN
ENRIVVSQREPLGVVSAILPFNFPVNSFAHKVAPAIAVGNSVVVKPSINTPLSALEMAKI
LVEAGLTEKAIRVVTGYSKEIGDELYTHPSISLVTLTGSTQTGLMIASKAVSLGKRIIME
LGGSDPIIVLEDADIERSSSISVRARYEYAGQNCNAGKRIIVREEIYERFVSSFEKKVKE
LRVGDPLDENTDVGPVINRESVENLNSVIDDAKSKGGKVEILNKGPDNGHFFPLTAVLKP
SLDMLVTKTEVFGPVAPIIPVKSDEEAIQVANSTDYGLQSAVFTKDVNRALRISKALKFG
AVIINDSTRLRWDSLPFGGFKKTGIGREGVRDTMLEMTENKLVSITLL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaactatagaggtcgtatctccctccaatttaaaagtcataggtaaagtgaaa
aggatgagtagagatgatgtaagggcacaaattgaagaggcagataagggtttcgaggat
atatcttcacttcccctatataagaggacggcaattctaaagagagcttcagatatcatt
gagagggaaaaagagagattagctaggttactagcccttgaggctggaaaaccaataaag
gatgccagagttgaggtaactagagcttcaagactattccgacaggcaggggaggaggca
gtttttgtattggagggtaaaaactacagggtagatgggtatgagtatcctcctggaaat
gaaaatagaattgtagtgagccaaagggaacctttaggagtggttagtgcaatactaccc
tttaactttcccgttaactcgttcgcccataaggtggctcctgcaatagctgtaggtaac
tctgtagtagtaaaacctagtattaacactccattatctgctctggagatggctaagatc
cttgttgaagcaggtttaacagagaaagctatcagagtagttactgggtatagtaaggag
ataggcgatgagctctatactcacccctcaataagcttagttacattaactggctctaca
cagactggtttaatgattgcgtcaaaggctgtttcactaggtaagaggataattatggag
ttgggaggatctgacccaataattgtattagaggacgcagatatcgaaagatcatcgtcc
atatcagttagagccagatacgaatacgctggacagaattgtaatgctggaaagaggata
atagtgagagaagaaatatatgagagatttgtgtcatcttttgagaaaaaggttaaggaa
ttgagagtaggtgacccactagacgagaacactgatgtaggacctgtaataaatagagag
agtgtggaaaacctcaactctgtaatagatgacgccaaatctaagggaggaaaagttgag
atactaaataaaggacctgataatggacatttctttccccttactgcagttctaaagccc
agcttagacatgttagttactaaaacagaggtatttggacctgttgcacctataatacca
gtgaaaagtgatgaggaagccattcaagtggctaactccacggattatggattgcaatca
gctgtgttcactaaggatgtaaacagggctctcaggataagcaaggctcttaagttcgga
gctgtaatcattaacgatagtacaagactgaggtgggattcactaccatttggtgggttt
aagaagaccgggataggaagagaaggtgttagagatacaatgctggaaatgactgagaac
aagttggtgtccataaccctcctgtaa

DBGET integrated database retrieval system