KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_04520Help
Entry
SUSAZ_04520       CDS       T02975                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
sacs00627  Aminobenzoate degradation
sacs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sacs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SUSAZ_04520
Enzymes [BR:sacs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SUSAZ_04520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: AHC51318
Position
complement(736697..737488)
Genome map
AA seq 263 aa AA seqDB search
MSLYNYDLIISDIDGVILREGEPIWPNFLAIKKLSEAGKKVLLLTNNSGFSRVLLSRQLS
YLGLKISPEYIVTSGTATAIYMKEQTNIKTVFVVGEEGLIEELKNFGFEVLGIREANEET
PDAVVIGLDRLSTYEKLSTAMRSVYKGSKFIVTNMDRLWPSKDGLKLGAGAIASTIIYAL
KRNPDFIAGKPNIWMIKVAFKIAGLTDFSRAIMIGDQLETDIKMGLNANIDTVLVLTGIN
TRKDLEASDIKPKFVVNTLTELV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcttatataactatgatctaattataagtgacatagatggtgtcatactgagagaa
ggagaaccgatatggccaaactttttagcaatcaagaaattgtcggaagccggtaagaag
gtacttttattaactaataattcaggcttcagtagagtcttactatcacggcaattaagc
tatttaggcttgaagataagtccagaatatattgttactagtggtacagcaactgcgata
tatatgaaggagcagacaaacattaagacagtttttgtggttggcgaagaaggattaatt
gaggaattgaaaaactttggatttgaagtattgggtataagagaagctaatgaggagaca
cctgatgcagtagttattggtcttgataggttaagtacttatgaaaaattgtcaacagcg
atgagatcagtatataaagggtctaagttcatagtcactaacatggatagattatggccg
tctaaggatgggcttaaattaggagcaggcgcaatagcctcaacaataatttatgcgtta
aagagaaatcctgatttcatagcaggaaaacccaacatctggatgataaaagtagcattc
aagattgctggattgacagatttttctagagcaataatgattggggatcagttagaaact
gatataaaaatgggattaaatgctaatatagacactgtgttagttttaactggtataaac
acaaggaaggacttggaggcatcggatataaaaccaaaatttgtggttaatacattaaca
gagttggtataa

DBGET integrated database retrieval system