KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_10805Help
Entry
SUSAZ_10805       CDS       T02975                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
sacs00790  Folate biosynthesis
sacs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sacs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SUSAZ_10805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sacs04147]
    SUSAZ_10805
Enzymes [BR:sacs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     SUSAZ_10805
Exosome [BR:sacs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUSAZ_10805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF1965
Motif
Other DBs
NCBI-ProteinID: AHC52321
UniProt: V9SB21
Position
1979603..1979878
Genome map
AA seq 91 aa AA seqDB search
MKLDENEIKRRLGEIEGWSYENNKLKKTFKFKNFYESVEFVRKIQPIADEMDHHPDLCVY
YNRVVLELSTHSEGGVTEKDFELAKKINKIH
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagatgaaaatgaaataaaaaggagattaggagaaatcgaaggatggagttat
gaaaataataagctcaagaagacattcaagtttaagaatttttatgagtctgtggaattc
gtaaggaagatacaacctattgctgatgaaatggatcatcaccctgacttatgtgtatat
tataacagggttgtgctagagctttcaacccatagtgagggcggagttactgaaaaagat
tttgaattagctaagaaaataaataaaattcattga

DBGET integrated database retrieval system