KEGG   Stenotrophomonas acidaminiphila: AOT14_01610Help
Entry
AOT14_01610       CDS       T04107                                 

Definition
(GenBank) UDP-glucuronic acid epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00520  Amino sugar and nucleotide sugar metabolism
sacz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOT14_01610
Enzymes [BR:sacz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     AOT14_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: ALJ26623
UniProt: A0A0R0DZ28
Position
complement(196089..197027)
Genome map
AA seq 312 aa AA seqDB search
MKRILVTGGAGFLGSHLCDRLVGSGHDVLCVDNFFTGSKRNVAHLLGNPGFELMRHDVTF
PLYVEVDRIFNLACPASPIHYQHDPVQTTKTSVHGAINMLGLAKRLDARILQASTSEVYG
DPEVHPQQEGYWGRVNPIGLRSCYDEGKRCAETLFFDYFRQHALDIKVVRIFNTYGPRMH
PSDGRVVSNFIVQALKGEDITIYGDGSQTRSFCYVDDLVDAMVRMMDSERGFTGPVNIGN
PGEFTMLELAEKVISLVGGSSRLVFQPLPQDDPKQRQPDIALARSALDWEPKVALDDGLR
ETIAYFRQVLAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcctggtcaccggcggcgccggctttctcggttcgcacctgtgcgatcgc
ctggtcggcagcggccacgatgtgctctgtgtcgacaatttcttcaccggcagcaagcgc
aacgtcgcgcacctgctgggcaaccccggcttcgagctgatgcgccacgacgtgacgttc
ccgctctacgtcgaggtggaccgcatcttcaacctcgcctgcccggcttcgcccattcat
taccagcacgacccggtccagaccaccaagaccagcgtgcatggggcgatcaacatgctg
ggcctggccaagcgcctggatgcgcgcatcctgcaggcgtccaccagcgaggtgtatggc
gaccccgaagtgcacccgcagcaggagggctactggggccgggtcaatccgatcggcctg
cgcagctgctacgacgagggcaagcgctgcgcggaaacgctgttcttcgattatttccgc
cagcacgcgctggacatcaaggtggtgcgcatcttcaacacctacggcccgcgcatgcac
cccagcgatgggcgggtggtcagcaacttcatcgtgcaggcgctcaagggcgaggacatc
accatctacggtgacggcagccagacccgcagcttctgctacgtggacgacctggtcgat
gccatggtccgcatgatggacagcgagcgcggcttcaccgggccggtcaacatcggcaat
cccggcgagttcaccatgctggaactggccgagaaggtgatctcgctggttggcggcagc
tccaggctggtgttccagcccctgccgcaggacgacccgaagcagcgccagccggacatc
gcgctggcccgctcggccctggactgggagccgaaagtggcgctggacgacggcctgagg
gagaccatcgcctatttccgccaggtgctggcggcatga

DBGET integrated database retrieval system