KEGG   Stenotrophomonas acidaminiphila: AOT14_05220Help
Entry
AOT14_05220       CDS       T04107                                 

Gene name
fadI_2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00071  Fatty acid degradation
sacz00072  Synthesis and degradation of ketone bodies
sacz00280  Valine, leucine and isoleucine degradation
sacz00310  Lysine degradation
sacz00362  Benzoate degradation
sacz00380  Tryptophan metabolism
sacz00620  Pyruvate metabolism
sacz00630  Glyoxylate and dicarboxylate metabolism
sacz00640  Propanoate metabolism
sacz00650  Butanoate metabolism
sacz00900  Terpenoid backbone biosynthesis
sacz01100  Metabolic pathways
sacz01110  Biosynthesis of secondary metabolites
sacz01120  Microbial metabolism in diverse environments
sacz01130  Biosynthesis of antibiotics
sacz01200  Carbon metabolism
sacz01212  Fatty acid metabolism
sacz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT14_05220 (fadI_2)
   00630 Glyoxylate and dicarboxylate metabolism
    AOT14_05220 (fadI_2)
   00640 Propanoate metabolism
    AOT14_05220 (fadI_2)
   00650 Butanoate metabolism
    AOT14_05220 (fadI_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT14_05220 (fadI_2)
   00072 Synthesis and degradation of ketone bodies
    AOT14_05220 (fadI_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT14_05220 (fadI_2)
   00310 Lysine degradation
    AOT14_05220 (fadI_2)
   00380 Tryptophan metabolism
    AOT14_05220 (fadI_2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOT14_05220 (fadI_2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT14_05220 (fadI_2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOT14_05220 (fadI_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sacz04147]
    AOT14_05220 (fadI_2)
Enzymes [BR:sacz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOT14_05220 (fadI_2)
Exosome [BR:sacz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT14_05220 (fadI_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALJ26967
UniProt: A0A0S1AVZ6
Position
599443..600723
Genome map
AA seq 426 aa AA seqDB search
MTRFAGPVYVAAGLRTPFGRGGGPLSAYDAVSLSVPVVKAMAAQAEPDLLVWGTVIPNMG
WSNIARETWLDAKLSPTVPAFSVVLACSTSMTATFAAAGMLGGGTELTMVGGSEVMSRPQ
IALTADASKRLTDLFARDPAAALGALQALTPRDYLLPTKGWANRITGRTMGDHMEETAKA
WQVTREAQDDWALKSHQRAVAGWERGFFDDLVIPLPELARDANPRADTSPERLAALKPVF
DRDSGKGSLTAGNSSPITDGAAGCWVATKAGLARLPTGTPYARLVDYEVSAVDFHTEGLL
MAPAYGIPRLLARNRLSFADIGLWEIHEAFASQVLANVAAISDPEWVRTKAGVQAAMGDF
NWDRVNPNGGSVAIGHPFGATGARDLSQAVKELWAMPPGSRAIVSICADGGQGTVALLER
PWMGDQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgactcgttttgccggacccgtttacgtagccgctggccttcgaacccctttcggacga
ggtggaggcccgttgtcggcctatgacgccgtgtccctgtcggtccctgttgtaaaggcg
atggcggcccaggcggagccagatctgctcgtctggggaacagtgattccgaacatgggc
tggagcaacatcgcccgcgagacctggctggacgccaagctcagtcccacggtgccggcg
ttctcggtcgtcctggcctgctctaccagcatgacggccacgttcgcggcggcggggatg
ctgggcgggggaacggaactcacgatggtcggcgggtccgaagtcatgagccgccctcaa
atcgccctgacggcagatgcatctaagcggctcacggatctgtttgcgcgcgatcccgcg
gctgcacttggcgccctccaagcccttaccccacgcgactatctgctgcccaccaagggc
tgggcaaaccggatcaccggccggaccatgggcgaccatatggaggagacggccaaggct
tggcaggtcacacgcgaggcgcaggacgactgggcgctcaagagtcaccagcgcgccgtg
gcgggatgggagcgtggcttcttcgacgatctcgtgatcccgctgccggagctggcgcgc
gatgcgaatccccgggctgatacgtcgcccgaacggcttgccgcactcaagccggtcttt
gatcgcgacagtggaaaggggagcctgacggcgggcaatagctccccgatcaccgatggc
gctgccggctgctgggtcgccaccaaggccggactggcccgactccccacgggcacgccc
tacgcgcggctcgtggactacgaggtgtctgcggtggatttccataccgaaggtctgctc
atggcgccggcgtatgggatccctcgcctgctcgcccggaatcgactgagcttcgccgac
atcgggctctgggagatccacgaggccttcgcgtcccaggtcctagcgaacgtggcggct
atttccgacccggagtgggtgcgcacaaaggccggcgtccaggcggctatgggcgatttc
aattgggaccgtgtcaatcccaacggaggctcggtcgccattgggcatccgtttggcgcg
accggcgcgcgtgacctgagccaggcggtgaaggagctctgggccatgcctcctggctcg
cgcgcgatcgtcagcatttgcgccgacggcggtcagggcacggttgcactcctcgagcgc
ccatggatgggagatcagtaa

DBGET integrated database retrieval system