KEGG   Stenotrophomonas acidaminiphila: AOT14_07240Help
Entry
AOT14_07240       CDS       T04107                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00520  Amino sugar and nucleotide sugar metabolism
sacz01100  Metabolic pathways
sacz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOT14_07240 (nagA)
Enzymes [BR:sacz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AOT14_07240 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALJ27160
UniProt: A0A0R0DT35
Position
819909..821048
Genome map
AA seq 379 aa AA seqDB search
MTRYALTNARVLGNDDFHSGHAVLVQDGKVAAVLPEASLPAGVPQHDLGGGWLLPGFIDV
QVNGGGGALLNNAPDVASLRTMMRGHRRFGTTGMMPTLISDDAAVMAQAIAAVRQAIAEG
VPGILGIHLEGPYIAPARKGTHDAAKFRVPGPDEVAMATSLDNGVTVITLAPERVPVETI
RAMVGNGAIVCAGHTAASYEQTRAGLDAGISGFTHLYNAMTPLQGREPGVVGAALEDPYS
WCGVIVDGVHVHPASLRVALAAKPRGKVLLVTDAMPMVGADDPSFALYGEVITAVDGVVR
NAAGSLAGSALDMASAVRNTVDLLGLPLAEAARMASTYPAQFLRVDDRYGHIAAGYQADF
VLLDDALQVQATWIAGQRE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttacgcattgaccaacgcccgtgtcctgggcaacgacgacttccactccggc
catgcggtgctggtgcaggacggcaaggtggccgcggtgctgcccgaggcgtcgctgcct
gcgggcgtgccgcagcacgatcttggaggcggctggctgctgccgggcttcatcgacgtg
caggtcaacggcggcggtggcgcattgctcaacaatgccccggacgtggcgtcgctgcgc
acgatgatgcgcgggcatcggcgcttcggcaccaccggcatgatgccgaccctgatcagc
gacgatgcggcagtgatggcccaggccatcgccgcggtgcgccaggccatcgccgaaggc
gtgcccggcatcctcggcatccacctggaaggcccgtacatcgcgccggcacgcaagggc
acccacgacgccgccaagttccgcgtgccggggccggacgaggtggcgatggcgacctcg
ctggacaacggtgtcaccgtgatcacgctggcgcccgagcgggttccggtggagaccatc
agggcgatggtcggcaacggcgccatcgtctgcgccggccataccgcggccagctacgaa
cagacccgcgccggcctggatgcgggaatcagcggcttcacccacctgtacaacgcgatg
acgccactgcaggggcgcgagcccggcgtggtcggcgccgcgctggaggatccgtacagc
tggtgcggggtgatcgtcgatggcgtgcacgtgcacccggccagcctgcgcgtggcgctg
gcggccaagccgcgcggcaaggtgctgctggtcaccgacgcgatgccgatggtgggcgcc
gacgatccttcgttcgcgctgtatggcgaggtgatcaccgccgtcgacggcgtggtgcgc
aatgccgccggctcgctggccggttcggcgctggacatggccagcgccgtgcgcaatacc
gtcgacctgctcgggctgcccctggccgaagccgcgcgcatggcctcgacctacccggcg
cagttcctgcgcgtggacgaccgctatgggcacatcgcggcgggttaccaggcggatttc
gtgttgttggatgacgccctgcaggtgcaggcgacgtggatcgcggggcagcgggagtga

DBGET integrated database retrieval system