KEGG   Stenotrophomonas acidaminiphila: AOT14_23130Help
Entry
AOT14_23130       CDS       T04107                                 

Definition
(GenBank) vitamin B12 transport protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00480  Glutathione metabolism
sacz00590  Arachidonic acid metabolism
sacz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AOT14_23130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOT14_23130
Enzymes [BR:sacz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AOT14_23130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: ALJ28681
UniProt: A0A0S1B107
Position
complement(2546594..2547163)
Genome map
AA seq 189 aa AA seqDB search
MSIRKCLIGIIFSLSVAGAAGAADGALLDRDYRPLAGKDPVNLNREYGGKVLLVVNTASK
CGYTPQYEGLEALHQALAGRGFSVLGFPSNDFRGQEPGSEAEIQEFCTLTYGVKFPMFQK
VHVTGAEATPLYRDLTRLTGVAPGWNFHKYLISRDGRVVAQFPSKVRPDDPELRAAIERE
LARPVPGRR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgcaagtgtctgattggaattattttttccctgtccgtagcaggcgcggcc
ggcgccgccgatggcgcgctgctggatcgcgactaccggccgctggccggaaaggacccg
gtgaacctgaaccgcgagtacggcggcaaggtgctgctggtggtgaacaccgcctccaag
tgcggctacaccccgcagtacgaggggctggaggccctgcaccaggcgcttgccgggcgt
gggttctcggtgctgggctttccctccaacgacttcaggggccaggagccgggcagcgag
gcggagatccaggaattctgcacgctgacctacggggtgaagttcccgatgttccagaaa
gtgcacgtgaccggcgcggaggccaccccgctttaccgtgacctcacccgcctgaccggc
gtggcgccgggctggaacttccacaagtacctgatatcgcgcgatggccgggtggtggcg
cagttccccagcaaggtgcggccggacgacccggaactgcgcgcggcgatcgagcgcgaa
ctcgcgcggccggtgccgggccgccgctga

DBGET integrated database retrieval system