KEGG   Stenotrophomonas acidaminiphila: AOT14_29340Help
Entry
AOT14_29340       CDS       T04107                                 

Definition
(GenBank) RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
sacz  Stenotrophomonas acidaminiphila
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sacz03009]
    AOT14_29340
Enzymes [BR:sacz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     AOT14_29340
Ribosome biogenesis [BR:sacz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AOT14_29340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ALJ29286
UniProt: A0A0S1B2U1
Position
3247039..3248088
Genome map
AA seq 349 aa AA seqDB search
MTGLLCYCRQGFEPELAAELTERAAHAGIAGYARTRRNDGYVVFASDDADALDRALPWRG
LIFARQKLRLLAELPQLDPADRISPIIAALQGQPRFGELWVEHPDSDAGKPLAGLARSFG
NALRPALRKAGLLTDKDNARLPRLHVVFVDGTHAFVGVADTRDSAPWALGIPRLKLLPEA
PSRSALKLDEALLTLLTPEEREALVKPGMRAADLGAAPGGWTWVLTRQHLHVTSIDNGPL
RQHVLDTGLVDHLRADGFHWQPETPLDWMVCDMVEQPRRVAERMATWMREGWCRHAIFNL
KLPMKKRWDETRLCLDLFAAQAGRPLTVRAKQLYHDREEITVLAMPARA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcctgttgtgctactgccgccagggcttcgagccggagctggccgccgaactg
accgagcgcgcggcccatgccggcatcgccggctacgcgcgcacccggcgcaacgacggc
tacgtggtgtttgccagcgacgacgccgacgcgctcgaccgcgcgctgccgtggcgcggg
ctgatcttcgcgcggcagaagctgcgcctgctggccgaactgccgcagctggacccggcc
gaccgcatcagcccgatcatcgccgcactgcagggccagccgcgcttcggcgagctgtgg
gtggaacaccccgactcggacgcgggcaagccgctggccgggctggcacgcagtttcggc
aacgcgctgcgcccggcgctgcgcaaggccgggctgctgaccgacaaggacaacgcccgg
ctgccgcgcctgcacgtggtgttcgtcgatggcacgcatgccttcgtcggcgtcgccgac
acccgcgacagcgcgccgtgggcgctgggcatcccgcgcctgaagctgctgcccgaggcg
ccctcgcgttcggcgctgaagctggacgaggcgctgctgaccctgctcacgcccgaggaa
cgcgaggcgctggtcaagccgggcatgcgcgcggccgacctgggcgccgcgcccggtggc
tggacctgggtactgacccgccagcacctgcacgtgaccagcatcgacaacggcccgctg
cgccagcacgtgctcgacaccgggctggtcgaccacctgcgcgccgacggcttccactgg
cagccggaaacgccgctggactggatggtctgcgacatggtcgaacagccgcgacgggtg
gccgagcgcatggccacctggatgcgcgaaggctggtgccggcatgcgatcttcaacctc
aagctgccgatgaagaagcgctgggacgagacccgcctgtgcctggacctgttcgccgcg
caggccgggcggccgctgaccgtgcgcgccaagcagctgtaccacgaccgcgaagagatc
accgtgctggcgatgccggcacgcgcctga

DBGET integrated database retrieval system