KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_0538Help
Entry
SAAV_0538         CDS       T01124                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00071  Fatty acid degradation
sad00072  Synthesis and degradation of ketone bodies
sad00280  Valine, leucine and isoleucine degradation
sad00310  Lysine degradation
sad00362  Benzoate degradation
sad00380  Tryptophan metabolism
sad00620  Pyruvate metabolism
sad00630  Glyoxylate and dicarboxylate metabolism
sad00640  Propanoate metabolism
sad00650  Butanoate metabolism
sad00900  Terpenoid backbone biosynthesis
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01120  Microbial metabolism in diverse environments
sad01130  Biosynthesis of antibiotics
sad01200  Carbon metabolism
sad01212  Fatty acid metabolism
sad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAAV_0538 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAAV_0538 (atoB)
   00640 Propanoate metabolism
    SAAV_0538 (atoB)
   00650 Butanoate metabolism
    SAAV_0538 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAAV_0538 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SAAV_0538 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAAV_0538 (atoB)
   00310 Lysine degradation
    SAAV_0538 (atoB)
   00380 Tryptophan metabolism
    SAAV_0538 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAAV_0538 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAAV_0538 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAAV_0538 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sad04147]
    SAAV_0538 (atoB)
Enzymes [BR:sad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAAV_0538 (atoB)
Exosome [BR:sad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAAV_0538 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACY10461
Position
589810..590949
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system