KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1137Help
Entry
SAAV_1137         CDS       T01124                                 

Gene name
arcB1
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00220  Arginine biosynthesis
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01130  Biosynthesis of antibiotics
sad01230  Biosynthesis of amino acids
Module
sad_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAAV_1137 (arcB1)
Enzymes [BR:sad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SAAV_1137 (arcB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ACY11045
Position
1158582..1159583
Genome map
AA seq 333 aa AA seqDB search
MKNLRNRSFLTLLDFSRQEVEFLLTLSEDLKRAKYIGTEKPMLKNKNIALLFEKDSTRTR
CAFEVAAHDQGANVTYLGPTGSQMGKKETTKDTARVLGGMYDGIEYRGFSQRTVETLAEY
SGVPVWNGLTDEDHPTQVLADFLTAKEVLKKDYADINFTYVGDGRNNVANALMQGAAIMG
MNFHLVCPKELNPTDELLNRCKNIAAENGGNILITDDIDQGVKGSDVIYTDVWVSMGEPD
EVWKERLELLKPYQVNKEMMDKTGNPNVIFEHCLPSFHNADTKIGQQIFEKYGIREMEVT
DEVFESKASVVFQEAENRMHTIKAVMVATLGEF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttacgaaacagaagttttttaactttattagacttttcacgacaagaggta
gaattcttattaacactctccgaggatttaaaacgtgctaaatatattggcactgaaaag
cctatgttaaaaaataaaaatattgcactgttatttgaaaaagattctacaagaacgcga
tgtgcatttgaagttgcagcgcatgatcaaggtgcaaatgtaacttatttaggcccaact
ggatcacaaatgggtaaaaaagaaacaactaaagatactgcacgtgtgcttggtggaatg
tatgatggcattgaataccgtggtttttcacaaagaacagtagaaactttagctgaatat
tcaggcgtaccagtgtggaatggtttaactgatgaagatcatcctactcaagttcttgct
gatttcttaacagcaaaagaagtcttaaaaaaagattatgcagatattaactttacatat
gttggagatggtcgtaataacgttgcaaatgcattaatgcaaggtgctgccattatgggt
atgaacttccatttagtttgtccaaaagaattaaatccaacagatgaattattaaatcgc
tgtaaaaatattgccgctgaaaatggtggcaacatattaatcacagatgatattgaccaa
ggtgtaaaaggttcggatgtaatttacactgatgtttgggtatcaatgggtgaacctgat
gaagtatggaaagaacgacttgaattattgaaaccatatcaagtaaataaagaaatgatg
gataaaactggtaatccaaatgttatttttgagcattgcttaccatctttccataatgct
gatacgaaaattggtcaacaaatttttgaaaaatatggtattcgagaaatggaagttaca
gatgaagtattcgaaagtaaagcttcagttgtattccaagaagctgagaacagaatgcat
acaatcaaagcagtcatggttgctacattgggtgaattttaa

DBGET integrated database retrieval system