KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1183Help
Entry
SAAV_1183         CDS       T01124                                 

Gene name
coaBC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00770  Pantothenate and CoA biosynthesis
sad01100  Metabolic pathways
Module
sad_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAAV_1183 (coaBC)
Enzymes [BR:sad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SAAV_1183 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SAAV_1183 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N adh_short_C2 Band_7
Motif
Other DBs
NCBI-ProteinID: ACY11089
Position
1204853..1206052
Genome map
AA seq 399 aa AA seqDB search
MKKILLAVTGGIAAYKAIDLTSKLTQSGYEVRVMLTNHAQKFVTPLAFQAISRNAVYTDT
FIEENPSEIQHIALGDWADAIIVAPATANTIAKLSVGIADDLVTSTLLATETPKFIAPAM
NVHMYENKRTQQNINILKEDGYHFIEPGSGFLACGYVAKGRMEEPLQIVSVIDAHFQNSN
RLANSSFQDKRALVTAGPTIEVIDPVRFVSNRSSGKMGYAIAEALRNRGAIVTLVAGPTT
LEDPKDIEVIHVQSAEEMFEQVTSRFDEQDIVVKAAAVSDYTPVDVLEHKMKKQDGDLSV
SFKRTKDILKYLGEHKTSQYLIGFAAETEDIENYAQQKLRKKNADVIISNNVGDMSIGFS
SDDNELTMHFKNNEKVNIKKGKKVVLAAQILDELETRWQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatattattagccgttacaggtggcattgcggcatataaagcaattgatttg
acaagtaagttaacacaatctgggtatgaagttcgcgttatgttaacgaatcacgcacaa
aaatttgtgacaccattagcatttcaagcaataagtcgaaatgctgtttatacagatact
tttatagaagaaaatccttcagaaatacagcatattgcattaggtgattgggcagatgca
atcattgttgcacctgcaacggcaaatacaattgcaaaattgagtgtaggtattgctgat
gatttggtgacatcaacgttgctagcaacagagacaccgaaatttattgcgcctgctatg
aatgtgcatatgtatgaaaataaacgtacgcagcaaaatattaatattttaaaagaagat
gggtatcattttatcgaaccaggaagcggatttctagcatgtggttatgttgctaaagga
cgtatggaagaaccgcttcaaatcgtttctgttattgatgctcattttcaaaatagtaat
cgtttagctaatagttcatttcaagataaacgcgcattggttacagcaggaccaactatt
gaagttatcgatccagtcagatttgtatccaatcgttcttctggaaaaatgggctatgca
atagctgaagcattgcgaaatcgaggagctatcgtgacgttagttgctggtcctacaaca
ctagaggatccaaaagatattgaagttattcatgttcaaagtgctgaagaaatgtttgaa
caagtgacaagccgatttgacgaacaagatattgttgtaaaagcagcagccgtatctgac
tatacaccggttgatgtattagaacataagatgaaaaagcaggatggtgatttgtcagta
tcttttaaacgtactaaagacattcttaaatatttaggtgaacataaaacatcacagtat
ttaataggctttgcagcagagactgaagatattgaaaattatgcacaacaaaaattacgc
aagaaaaatgcagatgtgattatttcaaataatgttggggatatgtctatcggatttagt
tctgatgataatgaattgacaatgcattttaaaaataatgaaaaggtaaatatcaagaaa
ggaaaaaaagtagtattagctgcacaaattttagatgaactagaaactaggtggcaataa

DBGET integrated database retrieval system