KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1697Help
Entry
SAAV_1697         CDS       T01124                                 

Definition
(GenBank) ftsk/spoiiie family protein
Organism
sad  Staphylococcus aureus subsp. aureus ED98
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE DUF87 AAA_10 DUF853 AAA_14 ResIII TrwB_AAD_bind T2SSE NACHT
Motif
Other DBs
NCBI-ProteinID: ACY11588
Position
complement(1751928..1753289)
Genome map
AA seq 453 aa AA seqDB search
MAMNEIALFKGVRIQPYFKHIDFIFAGVFAFIFLAYRILTLWQDYIRQQKALNVVEVYQY
FKPHFLYLVIGTAIVFLIAKLFSQFVLRFREKDLAEMIETQGFHNRTVIKKTTEYLDIDY
KKTEYDYYPTLFYKRKRKSFMIHVKKDGSRFQDHYLELEQIIEPMFNCELVEKRHIGRFL
RYEFMPLKYKKRIVMEGTEAPETTYYDTKIYITHQILWDFVKAPHALITGVTGGGKTYFL
FYMIRELFKRNAEVRLLDPKVSDLSFMKNVIGTEKVADTTGQIFKQLREANEEMERRFRM
MSESEHYKLGSNFRNFDLPPYFVIFDEVTAFTSTLDKKELQEMNDYLINIIMKGRQAGVF
MFLTAQRPDADVIKGNVRDQLGLRVSMGNLSADGYRMTFGQTDKVFQPIHESDIGRGYIS
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKER
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaatgagattgctttatttaaaggtgtgcgtattcaaccgtattttaaacat
attgattttatctttgcgggtgtgttcgcatttatctttttagcatatcgaatattaaca
ttatggcaagattatattagacaacaaaaagcgttaaatgtggttgaagtatatcagtac
tttaaaccacattttttatatcttgtgattggtacagcgattgtgtttttaattgcgaaa
ttattttcacaatttgttttaagatttcgcgaaaaagatttagctgaaatgattgaaacc
caaggtttccataatcgtacagttataaagaagacaacagagtacttagatattgattat
aagaagacagaatatgactactaccctacgttattttataagcgtaaacgtaaatcattt
atgatacatgtaaagaaagacggttcacgtttccaagatcattatttagagttggaacaa
atcatcgaaccaatgtttaactgtgagcttgttgagaagcgtcatattggacgtttcctc
agatatgagtttatgcctcttaaatataaaaaacgtatcgttatggaaggcacagaggca
ccagagacgacttattacgatacaaagatttatattacgcatcaaatcctttgggatttt
gtgaaagcaccacatgcattaattacaggtgtaacgggtggtggtaaaacatacttttta
ttttacatgattagggagttatttaaacgtaatgcagaagtgcgattattagacccgaaa
gtatctgatttatcatttatgaaaaatgtgattggcactgaaaaagtggcagatacaacc
ggacaaatttttaaacaacttagagaagcaaatgaagaaatggaacgccgttttagaatg
atgagtgaaagcgaacattataaattaggtagtaatttcagaaatttcgacttaccaccc
tactttgtgatttttgatgaagtgacagcgttcacttctactttagataaaaaagaactt
caagaaatgaatgattatttaatcaacatcattatgaaaggtcgtcaagctggcgtattc
atgtttttaacagcacaacgaccagacgcagatgtgattaaaggtaatgtacgtgaccaa
ttaggcttgcgtgtatcaatgggtaatttgtcagctgatggttaccgtatgacctttggt
caaacagataaagtattccaacctattcatgagtcagatattggacgtggttacatttcg
atattgggacaatataatgaaccgattttatttgatgcgccactcatggaacaatatgac
tttgtagaagatgtgaaacaaatattaaataaggagcgataa

DBGET integrated database retrieval system