KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1701
Entry
SAAV_1701         CDS       T01124                                 

Definition
(GenBank) conserved hypothetical protein, transposon-related protein
Organism
sad  Staphylococcus aureus subsp. aureus ED98
SSDB
Motif
Pfam: AAA_10 DUF87 Relaxase Sigma54_activat ABC_tran Sigma54_activ_2 CelTOS
Other DBs
NCBI-ProteinID: ACY11592
Position
complement(1754087..1756582)
AA seq 831 aa
MDLKAPYAGIKNNLLLTKNGEVWAYYRIRSESISTANYDAKEASKKRMKYFLESIKGYQD
FHFEMYEHDLDLRNKFKEISKDFDDTTFDVANYYAQETIDVLEQELQMITHNSFVMGVKL
RELSDDAVSIKEMVKSTLSDTAERMISNLGFNVSLDDKVLSRYESFERELADNFLSIEGE
RLTENELAYIVRKPFISNATHDVQEESARRAVTDVCNVVIDPTQMRVLKVTNENETFYTT
TVVVDDFPLDMEYTHIFEKAQNMPFPVECHIKAKIVENDKVKKKFDRAKINHKAQSREKQ
ATGDNASEEIQDNLFVLEQMEKEVTGSGVFMEWSCLFVIKSDDLRDCKRKAKRLVKRLKE
TEIYAVNPLADQLQLYYQVLHGNDLFINKYWVQRTTATGIAENLFGVSQSLGTKTGFYIG
RIDKFIRSVSREEAVASSRDIILFSLLLAAKGIKGAVSDSPHVLITGQTGKGKSFLAKLL
WLYTSFFKGQMIYWDPKSEFADWFNKITESEEMRRKYPLFVSHLETFKYVTLDYNKSNNF
GCLDPIVFLNGIEANEMLKSVFDEIKSFENYHHIETAIHQAISDTIDERENGETVGSLSV
IEKLQNHDDEAVRNAGDLLYQKTQNNILKLVFGNGENPALNIEEKITILQVKGLDIPKAD
DDPSTYSTSEQNGITLMLLIGKFLQKFGSRRQIQTTIFIDEGWAFSASRQGKKVAKGIKR
MGRSENNSLVFITQSVKDKADEDGGNFGCHFAFDEKDEREDILKSLDLEYSKESPENMEM
LKDLKKGQCIFSDFYGRVGKMAVHCPFEEMTEAFRTQEDSASSKAEEKFAI
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggatttaaaagcgccctacgcagggataaaaaacaatttattattaactaaaaatggc
gaagtttgggcgtattatcgtatacgttcggaatccatttcaacagcgaattatgatgct
aaagaagcgtctaaaaaacgtatgaaatactttcttgagtcgattaaaggttatcaagat
tttcattttgaaatgtatgaacatgatttagatcttagaaataagttcaaagaaattagt
aaagattttgatgatacaacatttgatgtcgcaaattattatgcgcaagaaacgatcgat
gtgttagaacaagaattacaaatgataacacataattcatttgtaatgggtgttaagctt
agagaattaagtgatgacgcggtttcaattaaagaaatggtaaaaagtacgttgtcagat
acagcggaacgcatgatttcaaatttaggctttaatgtctcgttagatgataaagtatta
agtcgttatgaaagttttgaacgtgaacttgcggataattttctgagtattgaaggcgaa
cgtttaacagaaaatgaactcgcttatatagtgagaaagccatttatttcaaatgcaaca
cacgatgtacaagaagagtcagcacgacgtgctgtcactgatgtttgtaatgtggtgata
gaccctacacaaatgagagtattgaaagtgacgaatgaaaatgaaacgttttatacaaca
acggttgttgttgatgattttccattggatatggaatatacacatatctttgaaaaagca
caaaatatgccgtttccagttgaatgtcatattaaagcaaagattgttgaaaatgataaa
gtgaaaaagaaattcgatcgcgcaaaaattaaccacaaagcacaatctagagaaaaacaa
gcgactggtgataatgcttcagaagaaatacaagataatttatttgtgttagaacaaatg
gaaaaagaagtgacaggctcaggcgtgtttatggaatggtcttgtttatttgtgattaag
agtgatgacctaagagattgtaagcgtaaagctaagcgtttagtgaaacgcttgaaagag
acggagatttacgccgtaaatcctctagctgaccaattacaattatattatcaagtctta
catggcaatgacttatttattaataagtattgggtacaacgcacgacggcgacaggtatt
gccgaaaaccttttcggtgtatcacaaagcttaggtacgaaaacaggtttttatatcgga
cgcattgataaatttatacgttccgtttcacgtgaagaagccgtcgcaagttcaagagat
attattctttttagtttattacttgcggcaaaaggtattaaaggggctgtgagtgatagt
ccacacgtattaattacaggtcaaacgggtaaaggtaagtcatttttagctaagctcctt
tggctatatacctcattctttaaagggcaaatgatttattgggacccgaaaagtgaattt
gcggactggtttaataagattacagaaagtgaagaaatgagacgaaaatatcccttgttt
gttagtcatttagagacatttaaatatgtgacattagattataataaatcaaataacttt
ggttgtttagacccgatcgtctttttaaatgggattgaagccaatgagatgttgaaatct
gtatttgatgaaattaaatcatttgaaaattatcatcatattgaaacagcgatacatcaa
gcgatttcagatacgatagatgaacgcgaaaacggtgaaaccgttggttcacttagcgtg
atagaaaagctacaaaaccatgatgatgaagctgtacgtaatgcgggtgatttgttgtat
cagaagacacaaaataatattttaaagttggtatttggtaatggtgaaaatccagcatta
aatattgaagaaaagataacgatattacaggttaaaggcttggatattccaaaagcagat
gatgacccttccacatatagtacaagtgaacaaaacggtattacattaatgttgttaatc
ggtaaattcttacaaaaatttggctcacgtagacaaattcaaacgaccatatttattgat
gaaggttgggcgtttagtgcgtcacgtcaaggtaagaaagtagcgaaaggcattaaacgt
atgggtcgatctgaaaataattcgcttgtctttattacacaatctgttaaagataaagcc
gacgaagacggcggtaactttggctgtcattttgcgtttgatgaaaaagatgaacgagaa
gatattttaaaatctcttgacttagaatattcaaaagaaagtcctgaaaacatggaaatg
ttgaaagacttgaagaaaggtcaatgtattttcagtgatttctacggacgtgtaggcaaa
atggctgtacattgtccatttgaagaaatgacagaagcatttagaacacaagaagactca
gcaagttcaaaagcagaagaaaaatttgcgatatag

DBGET integrated database retrieval system