KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1928Help
Entry
SAAV_1928         CDS       T01124                                 

Definition
(GenBank) conserved hypothetical protein, transposon-related protein
Organism
sad  Staphylococcus aureus subsp. aureus ED98
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACY11778
Position
1964717..1965001
Genome map
AA seq 94 aa AA seqDB search
MTEFTPFFDGSNQLNYRKFVILRFHGVSKRKICKMYNFAYFRILEVCEMAKKNDYRFTYK
DYKFLKQYGVSNTFICKMYHISIEDLEFFEVMNR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtttacacctttttttgatggttcaaatcaattaaattatcgtaaatttgta
attttaagatttcatggtgtttctaaaagaaaaatttgtaaaatgtataattttgcatat
tttcgtatattagaagtttgtgaaatggcaaaaaagaatgattatcgatttacttataag
gattataaatttttaaaacaatatggtgtgtctaatacatttatttgtaagatgtatcat
atttcaattgaagacttagaattttttgaggtaatgaaccgatag

DBGET integrated database retrieval system