KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1930Help
Entry
SAAV_1930         CDS       T01124                                 

Definition
(GenBank) conserved hypothetical protein, transposon-related protein
Organism
sad  Staphylococcus aureus subsp. aureus ED98
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3895 ThaI
Motif
Other DBs
NCBI-ProteinID: ACY11780
Position
1965486..1965788
Genome map
AA seq 100 aa AA seqDB search
MDYYTADRLYRYTNSSNLSEPILNYVASRINWGDKVSLMTLAKEIQSKFNDSYVKENTVK
GRPKIYADLCLLCMSLSEAGHGRMLQVNLEDCIYIGDIDV
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggattattatacagcagatagattatatcgctacacaaatagttcaaatttgagtgaa
cctattttaaactatgttgctagtcgtataaattggggcgataaagtttcattaatgact
ttagctaaagaaatacagtctaaatttaatgatagttacgttaaagaaaatacggtaaaa
ggtcggcctaaaatttacgctgacctttgtctattgtgtatgagcttgagtgaagcagga
catggcagaatgctacaagttaatttggaagattgtatttatattggcgatattgatgtt
taa

DBGET integrated database retrieval system