KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_1939Help
Entry
SAAV_1939         CDS       T01124                                 

Definition
(GenBank) conserved hypothetical protein, transposon-related protein
Organism
sad  Staphylococcus aureus subsp. aureus ED98
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIC Chordopox_G3 DUF3810 O-antigen_lig TMF_DNA_bd
Motif
Other DBs
NCBI-ProteinID: ACY11789
Position
1975667..1976257
Genome map
AA seq 196 aa AA seqDB search
MKQKIIMFTLVTVILFCAVLIGYQIPKQQVKMKQNQIEDLQEEQRILRDKNGELNKLVKR
QSKTVISDEEKQIREVSSNFVKQMFEMKKDSSFKSKAPQIKPLVTKDYYDTLFKDSKDKY
DLYDDITVNDIHVYFDTYDPKKDSYKVFVQFDERIETDGDDKIEHRQTSAQLDLVRTAEG
WRIDNLKRFNLKPLGR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaaattattatgtttactcttgtaacagtaatattattttgtgctgtttta
attggttatcagattcctaaacaacaagttaaaatgaaacaaaatcaaattgaagatttg
caggaagaacaacgtatattaagagataaaaatggagagttaaataaattagtaaagaga
caatcaaaaacagttatttctgatgaagaaaaacaaatacgtgaagtttcttcaaatttt
gttaaacagatgtttgaaatgaaaaaagattcttcttttaaatcaaaagcaccacaaata
aagcctttagttacaaaggattattacgatacattatttaaggattctaaagataaatat
gatttatatgatgatataacggttaatgatattcatgtttattttgatacttatgaccct
aaaaaagatagttataaagtttttgttcagttcgacgaacgtattgaaacagatggagat
gataaaattgaacatcgtcaaacatctgcacaattggatttagttcgtacagctgaaggt
tggcgtattgataatttaaaacgttttaatttaaaacctctaggacgttag

DBGET integrated database retrieval system