KEGG   Staphylococcus aureus subsp. aureus ED98: SAAV_2581Help
Entry
SAAV_2581         CDS       T01124                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, putative
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sad  Staphylococcus aureus subsp. aureus ED98
Pathway
sad00010  Glycolysis / Gluconeogenesis
sad00030  Pentose phosphate pathway
sad00051  Fructose and mannose metabolism
sad00680  Methane metabolism
sad01100  Metabolic pathways
sad01110  Biosynthesis of secondary metabolites
sad01120  Microbial metabolism in diverse environments
sad01130  Biosynthesis of antibiotics
sad01200  Carbon metabolism
Module
sad_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAAV_2581
   00030 Pentose phosphate pathway
    SAAV_2581
   00051 Fructose and mannose metabolism
    SAAV_2581
  Energy metabolism
   00680 Methane metabolism
    SAAV_2581
Enzymes [BR:sad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAAV_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: ACY12411
Position
2603725..2605689
Genome map
AA seq 654 aa AA seqDB search
MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKERLSTKELNDLTALVYYPEDKLKLIKSDFQSCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTINRNNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGHTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKELQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaaaagaattaaaaaagaagtatttagatttactatcccaaaat
tttgatactccagaaaaacttgcaactgaaattatcaatttagaatcaattttagaatta
cctaaaggtacggaacatttcgtcagcgatttacatggtgaatacgaagctttccaacac
gtattacgcaacggttctgggaatgtgcgagcgaaaatcaatgatattttcaaagagaga
ctttcaactaaggagcttaatgatttaactgctcttgtctactatccagaagacaaatta
aaattgattaaaagtgatttccaaagttgcggtcaacttaatgtctggtatatcacaaca
atcgaacatttaattgagttgattaaatattgttcttcaaaatatacgcgttcaaaactg
cgtaaagcattgccaaaacaatacgtttatattattgaggaactactgtataaaagtaat
gaatatcaaaataaaaaatcatattacgaaacacttgttaaccaagtaattgaacttaaa
caggcagatgatttaattattggactcgcttattccgtacaacgcttagtcgtcgatcat
ttacacgttgtcggtgatatttatgatcgtggaccacaaccagataaaattatggataca
ctgattaattatcattccctagatattcaatggggtaatcatgatgtgctttgggttgga
gcctatgctgggtcaaaagtatgcttagcaaacttacttcgaatttgtgcacgctatgat
aatttagatattatcgaagacgcttatggcattaatttaagaccactgcttactttagct
gaaaaatactatgacgcagataatcctgcttttaagcctaaaaaaagacctgacaaacac
gaacgtttaactcaacgtgaagaaagtcaaattactaaaattcatcaagctattgcgatg
attcaattcaagttagaaataccaattattaaacgtcgtccaaatttcgaaatggaagaa
cgtcttgtgcttgaaaaggttaattatgatacaaatgaaattacagtttatggtaataca
tacccgttgaaagacacatgtttccaaactatcaatcgtaataatccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggttcgctttacttaccatataatggtaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcatttgaaatt
gatggtcatacttacagcggccaagaattattagatgtgtttgagtatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatcgacggatttagtttggtatttatgg
actgggaaatattcgtcattatttggtaaacgcgcgatgactacgtttgagcgatatttt
attgcagataaagcttctcataaagaagaaaaaaatccatactatcatttacgtgaagat
gtgaatatggttcgtaaaatgctcagtgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaatcaatggcgaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggtttttcaaaagcttatcagtcaacaactggcattgca
ggctatacattgttgtataattcattcggaatgcaactcgttgcacaccaacaatttaac
gctaaagaaaaaatactttccgaaggtatcgatgaactttctataaagcgcgttgtagac
aaagaattacaacgtaagaagattcgtgataccaatattggtaaagagcttcaagctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system