KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0112
Entry
NWMN_0112         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09790  uncharacterized protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Brite
KEGG Orthology (KO) [BR:sae00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NWMN_0112
SSDB
Motif
Pfam: DUF454 Glyoxalase_2
Other DBs
NCBI-ProteinID: BAF66384
UniProt: A0A0H3K5N7
Position
complement(136435..136818)
AA seq 127 aa
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgacttattttaatcgtcattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgttttgctcga
agttcagatcgcttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga

DBGET integrated database retrieval system