KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0184
Entry
NWMN_0184         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00040  Pentose and glucuronate interconversions
sae00051  Fructose and mannose metabolism
sae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NWMN_0184
   00051 Fructose and mannose metabolism
    NWMN_0184
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     NWMN_0184
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C PrmA ADH_zinc_N_2 Methyltransf_25 Methyltransf_31 2-Hacid_dh_C UDPG_MGDP_dh_N DUF4179
Other DBs
NCBI-ProteinID: BAF66456
UniProt: A0A0H3KDP7
Position
238332..239375
AA seq 347 aa
MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
NT seq 1044 nt   +upstreamnt  +downstreamnt
gtgaaagcattgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattattaaagtacgagcgactggcatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattaaaggtatgccatttggtcatgaa
ttttcaggtgtagtagatgccattggaagtgatgttacgcatgttaatgtgggcgacaaa
gtgacaggttgcccagcaataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttattcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggttccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggtttgttagctattcaatgggca
cgaatatttggtgctgcacatatcatcgctatagatatagatgcgcataaactagatatt
gcaacatcattgggcgcacatcaaacaatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatttagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccgggcaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag

DBGET integrated database retrieval system