KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0273
Entry
NWMN_0273         CDS       T00557                                 
Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: HNHc_6
Other DBs
NCBI-ProteinID: BAF66545
UniProt: A0A0H3K818
Position
328706..329377
AA seq 223 aa
MQYITRYQKDNDGTYSVVATGVELEQSHIDLLENGYPLKAEVEVPDNKKLSIEQRKKIFA
MCRDIELHWGEPVESTRKLLQTELEIMKGYEEISLRDCSMKVARELIELIIAFMFHHQIP
MSVETSKLLSEDKALLYWATINRNCVICGKPHADLAHYEAVGRGMNRNKMNHYDKHVLAL
CREHHNEQHAIGVKSFDDKYHLHDSWIKVDERLNKMLKGEKKE
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcaatacattacaagataccagaaagataacgacggtacttattccgtcgttgctact
ggtgttgaacttgaacaaagtcacattgacttactagaaaacggatatccactaaaagca
gaagtagaggttccggacaataaaaaactatctatagaacaacgcaaaaaaatattcgca
atgtgtagagatatagaacttcactggggcgaaccagtagaatcaactagaaaattatta
caaacagaattggaaattatgaaaggttatgaagaaatcagtctgcgcgactgttctatg
aaagttgcaagggagttaatagaactgattatagcgtttatgtttcatcatcaaatacct
atgagtgtagaaacgagtaagttgttaagcgaagataaagcgttattatattgggctaca
atcaaccgcaactgtgtaatatgcggaaagcctcacgcagacctggcacattatgaagca
gtcggcagaggcatgaacagaaacaaaatgaaccactatgacaaacatgtattagcgtta
tgtcgcgaacatcacaacgagcaacatgcgattggcgttaagtcgtttgatgataaatac
cacttgcatgactcgtggataaaagttgatgagaggctcaataaaatgttgaaaggagag
aaaaaggaatga

DBGET integrated database retrieval system