KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0639
Entry
NWMN_0639         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09705  uncharacterized protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Brite
KEGG Orthology (KO) [BR:sae00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NWMN_0639
SSDB
Motif
Pfam: Cupin_5
Other DBs
NCBI-ProteinID: BAF66911
UniProt: A0A0H3KBE4
Position
722880..723353
AA seq 157 aa
MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaaatcagcagaacaatggattgatgaattgcaacttgaatcacatcctgaaggtggt
ttctatagagagacaattcgagaagtattgaaagatggacgcagagcgccgtttagtagt
atttattttttacttacagatgacaatatttcgcattttcatcgaattgatgctgatgaa
gtatggtactatcatgctggcgattctctaacaattcatatgataaatccggatggggaa
tatacgactgcaacattgggtactgatatccaaaatggagatgtattgcaatatgtagtg
cctaaaggaacaatttttgcttcttcaatcgaaatatcaaatacttttagtttagtaggt
tgtatgtgtcaaccggcatttgagtttaagcagtttgaattgtttaagcaatctgaatta
attacgcaatatccgcatcttaaatcagtaatcgaaaaatatgctttaaaataa

DBGET integrated database retrieval system