KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0801
Entry
NWMN_0801         CDS       T00557                                 

Name
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00630  Glyoxylate and dicarboxylate metabolism
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NWMN_0801
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     NWMN_0801
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored AdoHcyase_NAD IlvN
Other DBs
NCBI-ProteinID: BAF67073
UniProt: A0A0H3KBQ5
Position
889526..890485
AA seq 319 aa
MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
CINNIEAVMTNQVPHTPVN
NT seq 960 nt   +upstreamnt  +downstreamnt
ttggtaaaaatagttgtttcgaggaaaattccagataaattttatcaacaattaagtaaa
cttggtgacgttgttatgtggcaaaaatcattagtgcctatgcctaaagatcaatttgtg
acagcacttcgtgacgcagatgcttgttttattacattaagtgaacagatcgatgcagaa
attttagcgcaatcaccaaatttaaaagtaattgcgaatatggctgtaggatatgacaac
atcgatgttgaaagtgcaacagcgaataacgtggttgtcacgaatacaccaaatgtactt
actgaaacaactgcagaattaggatttacattaatgcttgctatagcacgccgtattgta
gaagctgaaaaatatgtagaagcagatgcatggcaaagctggggtccttatttattgtca
ggtaaagatgtcttcaattcaactattggaatatatggtatgggagatattggtaaagct
tttgcaagaaggttgcaagggtttaatactaatattctttatcataatcgatcaagacat
aaagatgcagaggcggactttaatgcaacatatgtttcttttgaaacgttgttagcagaa
agtgattttatcatctgtacagcgccacttacaaaagaaacacatcataaatttaatgct
gaagcatttgaacaaatgaaaaatgatgcaatttttattaatatcggtagaggacaaatt
gtagatgaaacagcattaatcgatgcactagacaataaagaaattttagcatgtggttta
gatgtattagcaaatgaaccgattgatcatacacatccattaatgggacgtgataatgtt
ctgattacaccacacattggtagcgcatcagtaacaacacgggacaatatgattcaatta
tgtattaataatatagaagcggttatgacaaatcaggtaccacatactccagtaaattga

DBGET integrated database retrieval system