KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0916
Entry
NWMN_0916         CDS       T00557                                 

Symbol
sspC
Name
(GenBank) cysteine protease precursor
  KO
K23597  staphostatin B
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Brite
KEGG Orthology (KO) [BR:sae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sae01002]
    NWMN_0916 (sspC)
Peptidases and inhibitors [BR:sae01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   NWMN_0916 (sspC)
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-ProteinID: BAF67188
UniProt: A0A0H3KC08
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(1014559..1014888)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgaccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system