KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0918
Entry
NWMN_0918         CDS       T00557                                 

Symbol
sspA
Name
(GenBank) V8 protease, glutamyl endopeptidase precursor
  KO
K01318  glutamyl endopeptidase [EC:3.4.21.19]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NWMN_0918 (sspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sae01002]
    NWMN_0918 (sspA)
Enzymes [BR:sae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.19  glutamyl endopeptidase
     NWMN_0918 (sspA)
Peptidases and inhibitors [BR:sae01002]
 Serine peptidases
  Family S1: chymotrypsin family
   NWMN_0918 (sspA)
SSDB
Motif
Pfam: Trypsin_2 Trypsin Peptidase_S46 Peptidase_S7 Peptidase_C3 Peptidase_S32 Peptidase_S39 Phytochelatin
Other DBs
NCBI-ProteinID: BAF67190
UniProt: A0A0H3KFL2
Structure
PDB: 
2O8L 1QY6 1WCZ

Position
complement(1016189..1017199)
AA seq 336 aa
MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNN
PDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaggtaaatttttaaaagttagttctttattcgttgcaactttgacaacagcgaca
cttgtgagttctccagcagcaaacgcgttatcttcaaaggctatggacaatcatccacaa
caaacgcagtcaagcaaacagcaaacacctaagattcaaaaaggcggtaaccttaaacca
ttagaacaacgtgaacacgcaaatgttatattaccaaataacgatcgtcaccaaatcaca
gatacaacgaatggtcattatgcacccgtaacttatattcaagttgaagcacctactggt
acatttattgcttccggtgtagttgtaggtaaagatactcttttaacaaataaacacgtc
gtagatgctacgcacggtgatcctcatgctttaaaagcattcccttctgcaattaaccaa
gacaattatccaaatggtggtttcactgctgaacaaatcactaaatattcaggcgaaggt
gatttagcaatagttaaattctcccctaatgagcaaaacaaacatattggtgaagtagtt
aaaccagcaacaatgagtaataatgctgaaacacaagttaaccaaaatattactgtaaca
ggatatcctggtgataaacctgtagcaacaatgtgggaaagtaaaggaaaaatcacttac
ctcaaaggcgaagctatgcaatatgatttaagtacaactggtggtaattcaggttcacct
gtatttaatgaaaaaaatgaagtgatcggaattcattggggcggtgtaccaaatgaattt
aatggtgcggtatttattaatgaaaatgtacgcaacttcttaaaacaaaatattgaagat
atccattttgccaacgatgaccaacctaataacccagataatcctgataaccctaacaat
cctgataaccctaacaacccagatgaaccaaataaccctgacaaccctaacaaccctgat
aatccagacaatggcgataacaataattcagacaatccagatgcagcttaa

DBGET integrated database retrieval system