KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0919
Entry
NWMN_0919         CDS       T00557                                 

Name
(GenBank) aminotransferase, class I
  KO
K00841  aminotransferase [EC:2.6.1.-]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00300  Lysine biosynthesis
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NWMN_0919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sae01007]
    NWMN_0919
Enzymes [BR:sae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     NWMN_0919
Amino acid related enzymes [BR:sae01007]
 Aminotransferase (transaminase)
  Class I
   NWMN_0919
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Other DBs
NCBI-ProteinID: BAF67191
UniProt: A0A0H3K7A7
Position
complement(1017727..1018881)
AA seq 384 aa
MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
ISYAYEMDVLKEGMKRLAKYLNTK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaaactttctttaaattctaattctaaatatttaagagcaccaagtattcgccaattt
tcaaatcgtatgaataatttggatgattgtgttaatttaactattggccaaccagacttc
ccgatgcctgatgttgtgaaaaaggcatatattgatgctattaacaatgacaagacatca
tactctcacaataaagggttattagaaactcgcgaagcaattagtcaatacttcaaaaat
cgttatcatttttcctatgatcctgaagaaattattgtgacaaatggagcaagtgaagca
atagacacaacgttacgttctatcatagagcctggagatgaaattataataccgggacca
atttatgcaggctacataccactcatcgaagtactaggtggtaaaccaatttatattgat
acaacagcaacacaatttaaaattacacctgatgcattagaaagtcatatttctccaaag
acaaaagctgtcttgttaaattatccgactaatccaactggcgtagttttaaaaagaaat
gaagttttaaatatcgtaaatgtattaaaaaaatatccgttatttattattagcgatgag
atttatgctgaaaatacatttagtggtaaacatgtatccttcgctgaatttgaagacatt
cgtgatcaattaatattaattggtggtttaagtaaatcacactcagcaaccggaataaga
attggttttctattaggacctcaatatttgattgataaattaacatttatgcacgcctat
aattgtatttgtgccaatgttccagctcaaatagcatgtataacagcacttaacgaagga
ttagaagctcctaaatatatgaacgaagcttatgtagaacgaagaaattatttagtatct
gaattaactaaattaggttttgagattaccgctcaacctgaaggcgcgttttatattttc
ccaagtattaaacatatcaccgatgacgatttcgaattttgtgtcgatttacttgaatca
acacatttagcaatcgttccaggctcatcctttacagaattcggtaaaggatttgtaagg
atttcctatgcttatgaaatggatgttttaaaagaaggtatgaagagacttgctaaatat
ttaaatactaaataa

DBGET integrated database retrieval system