KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0920
Entry
NWMN_0920         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Motif
Pfam: Acyl_transf_3
Other DBs
NCBI-ProteinID: BAF67192
UniProt: A0A0H3K804
Position
complement(1019077..1020087)
AA seq 336 aa
MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgacttcattaaaagagagagattatttttttgacaacgcaagagcaattttaatatta
ttagtcgtatttggacatatgttacaaccctacactagtggcgataaatatttatcagca
ttatacctagttatttatagtttccatatgccaacatttttgtttatatctggttatttc
gcgaaaaatattgataaaccatactatttagaaaaaatttcaaaacgtttgatagtacct
tatatgatattttttgcattcttttcaatttattatttcttaacaggtaaaagtgacgaa
ttacaacttgatccttttaacccagtatttgcgttatggtttttgatcacgctatttttc
tttcatgtcattttagtaatagttagaagatttaatccatataaagtgctatcagtttca
attattatatctattggagcaggtttttcagataacatcgatagctacttaagcatttca
aggacaatcgtatttttcccaatattttatctaggttacattttcaccaaaaaacatacg
gctatttttaaaaataaaaaactaataccagtatctatcattacctttattttgtttttt
atcgtttacgtgattcatcctatcaatgcagattggttattgggaagttcaccatatact
tcacttgaaaatgaaggacagagtatattcagtccttttaaacgacttatattatatgga
attatattaatcgcaatgactgcgtttctaaatttaatgtcaacaaagaaaaaattatat
acttatattggtagtcgtacgctatacgtatatttattacatggtttaattattggcatt
gttagaggatttgaatggtacccattcgataatcctatatcattaatgacttatctttat
ttaataagtatatctgtaatcatcgtatatgtattatctacaaactttgtttgtaaatgg
acaaatccaataattaatttacaaagaccatcacagtttaaagattcataa

DBGET integrated database retrieval system