KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0921
Entry
NWMN_0921         CDS       T00557                                 

Name
(GenBank) ATL autolysin transcriptional regulator
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB
Other DBs
NCBI-ProteinID: BAF67193
UniProt: A0A0H3KC12
Position
1020240..1020659
AA seq 139 aa
MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcacatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa

DBGET integrated database retrieval system