KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0963
Entry
NWMN_0963         CDS       T00557                                 

Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: UPF0223 Tk-SP_N-pro
Other DBs
NCBI-ProteinID: BAF67235
UniProt: A6QFV3
Position
1070171..1070446
AA seq 91 aa
MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIF
NTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaatatgagtatccaattgatttagactggagtaatgaagagatgatttcagtgata
aatttctttaatcatgtagagaagtattatgaatccggcgtgacggcaggcgactttatg
ggtgcatataaaagatttaaagaaattgtgcctgctaaagcagaggaaaaacaaattttt
aatactttcgaaaaaagtagtggctataatagttacaaagcagttcaagatgtaaaaact
cactctgaagaacaaagagtaacagctaaaaaataa

DBGET integrated database retrieval system