KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1075
Entry
NWMN_1075         CDS       T00557                                 

Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: SSL_OB Stap_Strp_tox_C
Other DBs
NCBI-ProteinID: BAF67347
UniProt: A0A0H3KFW3
Position
complement(1178781..1179497)
AA seq 238 aa
MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtaagaacatcacgaaaaatataattttaacgacaacattattactattaggtact
gtattacctcaaaatcaaaaaccagtatttagtttttactctgaagctaaagcttatagc
attggtcaagatgaaactaacatcaatgaattaattaaatattacacacagcctcatttt
tcattttcaaataaatggctatatcaatatgataatggaaacatttatgttgaacttaag
agatattcatggtcagcacatatatctttatggggcgctgaaagttggggaaatattaat
cagttaaaagatcgttacgtagatgtgtttggactaaaagacaaagatactgatcagtta
tggtggtcttatagagagacatttacaggtggcgttacaccagccgcaaaaccttctgat
aaaacttataatctttttgtgcaatacaaagataaactacaaacgattattggtgcgcat
aaaatataccaaggcaataaaccagtattaacattgaaagaaatcgatttccgtgcacga
gaagcgttaataaaaaataaaatattatataacgaaaatcgtaataaaggtaagcttaag
atcaccggtggcggtaataactacactattgatttaagcaaaagattacattcagatcta
gcaaatgtttatgttaaaaatcctaataaaataactgttgacgtcctctttgattag

DBGET integrated database retrieval system