KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1146
Entry
NWMN_1146         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09787  uncharacterized protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Brite
KEGG Orthology (KO) [BR:sae00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NWMN_1146
SSDB
Motif
Pfam: UPF0122 Sigma70_r4 Sigma70_r4_2 HTH_38 HTH_11 HTH_23 Sigma70_ECF HTH_Tnp_1_2 HTH_7 HTH_10 HTH_28 HTH_17 TrmB HTH_40 HTH_29 DUF1492 Terminase_5 HTH_22 GerE Syntaxin-6_N AAA_23
Other DBs
NCBI-ProteinID: BAF67418
UniProt: A6QGD6
Structure
PDB: 
1XSV

Position
1257532..1257864
AA seq 110 aa
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
NT seq 333 nt   +upstreamnt  +downstreamnt
atgggtcaaaatgatttagttaaaacgttacgaatgaattatttgtttgatttttatcaa
tccttattgacgaataaacaacgtaattatttggaattattttatcttgaagattattct
ttaagtgaaatcgcagatacttttaatgtgagtagacaagcagtttatgataatataaga
agaactggcgatttagttgaagattatgaaaagaaattggaattataccagaaatttgag
caacgccgagaaatatatgatgaaatgaaacaacatttaagtaatccagaacaaatacaa
cgttatattcaacaattagaagacttagaatag

DBGET integrated database retrieval system