KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1396
Entry
NWMN_1396         CDS       T00557                                 

Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: DUF1672 tRNA-synt_1c DUF6491
Other DBs
NCBI-ProteinID: BAF67668
UniProt: A0A0H3K883
Position
complement(1564195..1565112)
AA seq 305 aa
MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
YRKDE
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtttaaaagaactaaactaatcttaatagcaacattactgctatcaggatgttcaact
accaataacgaatctaataaagaaacaaaatcagtgccagaagaaatggaagcttcaaaa
tatgtaggtcaaggcttccaaccacctgcagaaaaagatgtggttgaatttgcgaaaaag
cataaagataaaattgccaaacgaggcgaacaattttttatggataatttcggtctaaaa
gttaaagctaccaatgttgtaggtagtggaaaaggcgtagaagtattcgtgcattgtgat
gaccacgatatcgtatttaatgcgagtattccatttgataaatcaataattgagagtgat
agctcattaagaagtgaggacaaaggcgatgatatgagtactttagttggtacagtgttg
agtggctttgaatatcgaacacaaaaagaaaagtatgacaatttatataaatttttcaaa
gataatgaagagaaataccaatatacaggctttacaaaagaagcaataaacaagacgcaa
aatgtcggatataaaaatgaatatttttatatcacttactcgtcaagaagcttaaaagaa
tatcgtaagtattacgaaccattgattcataaaaatgataaagaatttaaagaaggaatg
gaacaagccagaaaagaagtgaattacgctgctaatacagatacagtaacaacattgttt
agtacaaaggaaaattttactaaagacaatacagttgatgatgtaattgaactgagtgat
aaactatataattttaaaaataagccagaaaaatctacaattacaattcaaataggaaag
cctactattaatactaaaaaagccttttatgatgataatgatccaatagaatatggagtg
tatcgtaaagatgaataa

DBGET integrated database retrieval system