KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1527
Entry
NWMN_1527         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: CsbD TBCA Etd1 MT0933_antitox DUF6353
Other DBs
NCBI-ProteinID: BAF67799
UniProt: A0A0H3K8J1
Position
complement(1692649..1692831)
AA seq 60 aa
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
NT seq 183 nt   +upstreamnt  +downstreamnt
atggcagacgaaagtaagttcgatcaatttaaaggaaatgttaaagaaacagtaggtaac
gttactgataacaaagaattagaaaaagaaggtcagcaagataaagtgattggtaaagca
aaagaagttgttgaaaatgctaaaaacaaaataactgatgcaattgataaacttaaaaaa
taa

DBGET integrated database retrieval system