KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1770
Entry
NWMN_1770         CDS       T00557                                 

Definition
(GenBank) phage holin
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Motif
Pfam: Holin_SPP1 Turandot DUF3783
Other DBs
NCBI-ProteinID: BAF68042
UniProt: A0A0H3KHD9
Position
complement(1982340..1982642)
AA seq 100 aa
MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
NT seq 303 nt   +upstreamnt  +downstreamnt
atggatgcaaaagtaataacaagatacatcgtattgatcttagcattagtaaatcaattc
ttagcgaataaaggtataagtccgataccagtagatgaagaaagtgtttcatcgattatc
ttaacagttgttgctttatatactacatataaagataatccaacatctcaagaagggaaa
tgggcgaatcaaaaattaaagaaatataaagctgaaagtaaatatagaaaagcaacagga
caagcacctattaaagaagtaatgacacctacgaatatgaacgacacaaatgatttaggg
tag

DBGET integrated database retrieval system