KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1809
Entry
NWMN_1809         CDS       T00557                                 
Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: AAA_24 ATPase_2 Gasdermin TsaE
Other DBs
NCBI-ProteinID: BAF68081
UniProt: A0A0H3K9E4
Position
complement(2015799..2016587)
AA seq 262 aa
MTEEKQEPQEKVSILKKLKINNIAEKNKRKFYKFAVYGKIGSGKTTFATRDKDAFVIDIN
EGGTTVTDEGSDVEIENYQHFVYVVNFLPQILQEMRENGQEINVVVIETIQKLRDMTLND
VMKNKSKKPTFNDWGEVAERIVSMYRLIGKLQEEYKFHFVITGHEGINKDKDDEGSTINP
TITIEAQEQIKKAITSQSDVLARAMIEEFDDNGEKKARYILNAEPSNTFETKIRHSPSIT
INNKKFANPSITDVVEAIRNGN
NT seq 789 nt   +upstreamnt  +downstreamnt
atgactgaggaaaaacaagaaccacaagaaaaagtaagcatactcaaaaaactaaagata
aataatatcgctgagaaaaataaaaggaaattctataaatttgcagtatacggaaaaatt
ggctcaggaaaaaccacgtttgctacaagagataaagacgctttcgtcattgacattaac
gaaggtggaacaacggttactgacgaaggatcagacgtagaaatcgagaactatcaacac
tttgtttatgttgtaaattttttacctcaaattttacaggagatgagagaaaacggacaa
gaaatcaatgttgtagttattgaaactattcaaaaacttagagatatgacattgaatgat
gtgatgaaaaataagtctaaaaaaccaacgtttaatgattggggagaagttgctgaacga
attgtcagtatgtacagattaataggaaaacttcaagaagaatacaaattccactttgtt
attacaggtcatgaaggtatcaacaaagataaagatgatgaaggtagcactatcaaccct
actatcactattgaagcgcaagaacaaattaaaaaagctattacttctcaaagtgatgtg
ttagctagggcaatgattgaagaatttgatgataacggagaaaagaaagctagatatatt
ctaaacgctgaaccttctaatacgtttgaaacaaagattagacattcaccttcaataaca
attaacaataagaaatttgcaaatcctagcattacggacgtagtagaagcaattagaaat
ggaaactaa

DBGET integrated database retrieval system