KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2109
Entry
NWMN_2109         CDS       T00557                                 

Name
(GenBank) truncated MHC class II analog protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: MAP
Other DBs
NCBI-ProteinID: BAF68381
UniProt: A0A0H3KEC5
Structure
PDB: 
1YN4

Position
2347265..2347690
AA seq 141 aa
MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
NDDAKNSIDPSTIKQIQIVVK
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaaactaaaatcatttgttactgccactttagcattgggattattatcaacggtcgga
gctgcattaccgagtcacgaagcatctgcagatagtaataacggctataaagaaatgact
gtggatggttatcacactgttccttacacaatttcagtagatggtattactgcattacat
cgaacttactttatcttcccagaaaataaaaatgttctttatcaagaaattgacagtaaa
gtaaaaaatgaattagcttctcaacgtggtgttacaacagaaaaaattaataatgcccaa
acagcaacttatacgcttactttgaatgatggtaataaaaaagtagtgaatctaaagaaa
aatgacgacgctaaaaattcaattgatccaagtacaatcaaacagatacaaattgtagtt
aaataa

DBGET integrated database retrieval system