KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2171
Entry
NWMN_2171         CDS       T00557                                 

Gene name
moaE
Definition
(GenBank) molybdopterin synthase large subunit
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00790  Folate biosynthesis
sae01100  Metabolic pathways
sae01240  Biosynthesis of cofactors
sae04122  Sulfur relay system
Module
sae_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NWMN_2171 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    NWMN_2171 (moaE)
Enzymes [BR:sae01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     NWMN_2171 (moaE)
SSDB
Motif
Pfam: MoaE AhpC-TSA
Other DBs
NCBI-ProteinID: BAF68443
UniProt: A0A0H3K9Z8
Structure
PDB: 
2Q5W 2QIE

Position
complement(2395659..2396105)
AA seq 148 aa
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcggtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaat
tatgaagaagcgaagagggaggaataa

DBGET integrated database retrieval system