KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2252
Entry
NWMN_2252         CDS       T00557                                 
Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: UCH_N
Other DBs
NCBI-ProteinID: BAF68524
UniProt: A0A0H3KIH3
Position
2473803..2474441
AA seq 212 aa
MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacaaatccaaatcaacgattagaaccatttgatgagacatttcaacaaccgaatatt
catcgtggtaagcgatatggtaagaaaaaacgttcattggtaagcatgattattcaaatc
attgttgttatattaaccgcaatcgctggatacagcatgtggaaacaacccatttttaat
attgtcttcaccaaagaatctgtagattttgatggcattaaaaattttaacgagacaatt
ggaaaaatgcatcaattaaatattaatttgggtaatattaatgatttacaacaaggaatc
gatcgcttaattttagtctttaacggtttctttattttatgtatcgttagcctagtcata
acaatactgacaattgtatttaatcgcacagttctaaaagtagtaaatattttagtgtta
acaattatgttagtcattacattgtatttcagttatattattaaagcactcgcacaagaa
attgcagatgttttcaaaaaatattatttaaatgtaccaccagatcaagtgattacagaa
gctgacgctattcataacggcatcattttacttggctgtagcatcggtttacttgttata
agcttattcttccgtaatcgcatgcctcgtttaaaataa

DBGET integrated database retrieval system