KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2254
Entry
NWMN_2254         CDS       T00557                                 
Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD_2 CusB_dom_1 DUF6672 DUF2118 PASTA Peptidase_M23 DUF3221 SurA_N_3
Other DBs
NCBI-ProteinID: BAF68526
UniProt: A0A0H3KA50
Position
complement(2476631..2477278)
AA seq 215 aa
MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaaaagatgatattaattaatgtcattacggttgttgtactgttagcaattgggatt
gctggcttttatttttggaataaaacaacaagctatgtaacaactgataatgcaaaagta
aatggcgatcaaattaaaatagcaagtcctgcatctggacaaattaaatcacttaatgtt
aaacaaggtgacaaactcgataaaggtgacaaagtagcaattgttactgtacaaggtcaa
gatggcgaaacgaaagatatggatcttaaaatgcctcaaaaaggtacaattgccaaatta
gatggtatggaaggttcaatggtgcaagctggtaacccaatcgcttatgcatacaattta
gatgatttatatgtaacagcaaatattgacgaaaaagatattaaagatgttgaagtaggt
aaagatgttgatgtgactattgacggtcaaaaagcttctattaaaggtaaagttgatagt
attggaaaagcaactgctgcaagcttttcattaatgccatcatcaaatagtgatggtaac
tacactaaagtttctcaagtaatacctgttaaaatcactctagaatcagaaccgtctaaa
caagttgttcctggaatgaacgctgaagtaaaaatccataaaaattaa

DBGET integrated database retrieval system