KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2313
Entry
NWMN_2313         CDS       T00557                                 

Definition
(GenBank) amino acid ABC transporter, amino acid-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae02010  ABC transporters
sae02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:sae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NWMN_2313
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    NWMN_2313
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sae02000]
    NWMN_2313
   02035 Bacterial motility proteins [BR:sae02035]
    NWMN_2313
Transporters [BR:sae02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    NWMN_2313
Bacterial motility proteins [BR:sae02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    NWMN_2313
SSDB
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd InPase NMT1 SspK
Other DBs
NCBI-ProteinID: BAF68585
UniProt: A0A0H3KAB2
Position
complement(2539813..2540592)
AA seq 259 aa
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag

DBGET integrated database retrieval system