KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2546
Entry
NWMN_2546         CDS       T00557                                 

Name
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: DUF6365
Other DBs
NCBI-ProteinID: BAF68818
UniProt: A0A0H3KFC6
Position
complement(2806865..2808223)
AA seq 452 aa
MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
QQFRDALLAQKAHAHEISREQFEQVFKQALES
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgattaaattatttgattactttaacgatcattcacgaaagttatatgagtcttttaaa
gccagtaagttggaagaagatttaacaattgtactcaatgacaatggctttttaccggac
gatgttatatcaccgtatcaattttttgcagataatcataatacagaaaatatgaaacca
cgattttttaatcaggttactgtaccagctttttgggaaattaaaggtaacaacaattcg
gctacaattaatgatatgggacgtctacgaggtaaaatattttatcaaagtggagagcgc
cctagaattgttagtcgtgtcgaatggtttgatgaccaacaacgtgtccgatttgtcgat
tattattctaagaatggtattaaatttgcacaaactgtttacgatttaaatcgtaaagcg
atcttgaagaaatatatgacagcagaaggtaaagaagtgatttatgaaaattttgtaaca
tctgatgtcatattggattggcaagggaagtcttactttttcccttcaaagctcgcattc
gcattattttttatcaagcaacttgaaattacggaacatcatttcgttattaactcacta
gccctaccattttcagtgttatataatttgccatcaaaaggtagtgatgttttggtatgg
caagaacactgtaatggtaatgtcccgggaaatatgcaattgatgtgtaaaggtgatatg
aaacgacattgtaatattattattccagataaaaacgaatatgaaacgatgctcaatata
gcagacgcaaaggttcaatctcgtattttacaaggcggatatctatataactatcgtagt
cgtaatagatatactaaagaaattgtaatattaactaactcggatcaacttcgtaacatc
aaggtattggttgaaactttaccagattttaagtttcacatcgctgctattacagagatg
tctgataagctaatgcaacttgatcaatatgctaatgtgcatttatacccatctattaat
attgacagggtaaatgaactataccagttatgtgatatttatcttgatatcaatgagggt
aatgaaattttaaatgcggtggaacaagcgtttgactatgagttgttgattttaggttat
cgtcaaaccgcacaccatgctaaagtaacattatcagagcacttatttgagcataatgat
gagataacaatggaaagtaaagaccaattaatacaaatgttagaaagtttgaaagatcaa
caacagtttcgagatgctttattagcacaaaaagcacatgcacacgaaatctcgcgtgaa
caattcgagcaagtttttaaacaggcgctcgaaagctaa

DBGET integrated database retrieval system